KEGG   Achromobacter xylosoxidans A8: AXYL_06383Help
Entry
AXYL_06383        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:axy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AXYL_06383
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:axy02044]
    AXYL_06383
Secretion system [BR:axy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AXYL_06383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C AAA_28
Motif
Other DBs
NCBI-ProteinID: ADP19676
UniProt: E3HRQ7
Position
complement(6860391..6864020)
Genome map
AA seq 1209 aa AA seqDB search
MIYRLFGWFFSRRVWNFLGLVALAVLIWIAGPLIAIGTVRPLESETVRIAVIVAMFAIWL
LRLLWRKWREGRLNAQLLSQLRRPKPKADKPLEEAAGNDEIRQLEARFHEAVELLRKTRF
ESRGRRGALDRFSKQYLYQLPWYVIIGAPGAGKTTALVNSGLNFPLAERYGKVALRGVGG
TRNCDWWFTDDAVLLDTAGRYTTHESDPTGDEEEWRGFLGLLSKYRGRQPINGAMLTVSV
EDLLSASDAERAQHAAVLRRRLQELREQLGIAFPVYVLVTKTDLLSGFEEYFASFTREEL
AQIWGFTLPYARAQEPDFDLYEAFHEEYALLQRRLDDALPEVVAAESDPARRALAYMLPQ
QFAGLQAILGHFLSDVFATSKFEARVIPRGVYFTSGTQGGETFDQVTGHLKRYLRIDGGA
ASAASVPGEGEGRSYFLKNLLQDVIFREAGLASRNLRWERRYRQLHWAGYGLVTAAFVAL
IGGWAMSYRNNADYVEEVARRVPAVEKLTRDIKITRTGDLLGLMPFLDSLWYLPQHEGFE
IDNPPLSYRYGLYQGQKLQAAAQGVYGNTLDQVLLPQVARRVETALRDASASDLEYSYEA
LRAYLMLYEAERYDAEFMHAWLLSDMQATLPEGYTRRQYEQLSLHLRNLTQSHVLASPFP
KDDALVAQAREKLARYTLAQRAYSRLRRTLANADAAPEITVVTLGGAQASAVFVRKSGKP
LSQGIPALYSYRGYWDVFNKRVTGVAEVLRSDDAWILNIPLRSQLDQTAQRQLVVDIKRL
YMNDYVAQWDGYLNDLQLAPSKSLLQNIQMARTLSAPESPLVRLVRGVARETSLLRDTGK
DDRSLVDQARDRVSSTREALEQMFGPTGPGAAMRADASDEKLERIVDQHFEPYRRLAEGE
GATAGAASPIAATTGLINELYTYLTAADAALRSGSPAPSSDAVTKLRAEAGRLPGPLRDV
LNSLSVNASGEVSDVARARMGETVSATIGMFCSQSVAGRYPFSGRSTRDVAPNDMARLFG
PNGLMDDFFQKNLANQIDVSGQRWRFKPGIDGKSGENSGTLDAFQRAGVIRDVYFMAGNP
MPSYRVAIRPVEMDADITQFVMDVDGQAVRYAHGPQVATTVQWPGPRGSNQVRIELTPQE
GAAGMTTSGPWALNRMLDRAQLRRGATAEITLATFDLGGRKVVLEITASSVKSPFHLAEM
QAFACPGAS
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgatctacaggctgttcggatggttcttcagccgccgcgtgtggaacttcctggggctg
gtggccctggcggtgctgatctggatcgcagggccgcttatcgcgatcggcaccgtgcgc
ccgctggaaagcgaaacagtgcgcattgcggtcatcgtggcgatgttcgcaatctggctg
ctgcggttgctgtggcgcaaatggcgcgaggggcgtttgaacgcacagttgctgagccag
ctgcggcggcccaagcccaaggcggacaagcctttggaggaggccgccggcaatgacgag
atacgccagctggaggcgcggttccacgaggccgtggaactgctgcgcaagacacgcttc
gagagccgtggcaggcgcggcgcgctggaccggttctccaagcagtatctgtaccagttg
ccctggtacgtgatcatcggtgcgccgggcgcgggcaagaccaccgcgctggtgaattcg
gggctgaactttcccctggcggaacgctatggcaaggtggccctgcggggagtgggcggc
acccgcaattgcgactggtggtttaccgacgatgccgtgctgttggacacggctgggcgc
tacaccacgcacgaaagcgatccgactggcgacgaggaagagtggcgcggctttctcggc
ctgctgtccaagtatcgcggccggcagcccattaatggcgccatgctgacggtcagcgtc
gaagacctgctgtcggcttccgacgcggaacgggcgcagcatgcggcggtgttgcgacgc
cggctgcaggaactgcgtgaacagttgggcatcgcgtttccggtctatgtgctggtgacc
aagaccgacctgctgtcgggcttcgaagagtatttcgcttccttcacccgcgaggaactg
gcgcagatatggggcttcaccttgccgtatgcgcgcgcgcaggagccggacttcgacctg
tacgaggcctttcacgaggaatatgccctgttgcagcggcgcctggatgacgccttgccc
gaagtggtggcggccgagagcgatccggcgcggcgcgcgctcgcctatatgctgccgcag
cagttcgccggcctgcaggccatcctgggccatttcctgagcgatgtgttcgcgacctcg
aaattcgaggcgcgcgtcattccacgaggcgtctacttcaccagcggcacgcagggcggc
gaaaccttcgaccaggtgaccgggcatctgaagcgctacctgcgcatcgacggcggcgcc
gcgtccgcggccagcgtaccgggtgaaggagagggccgcagctacttcctgaaaaatctg
ctgcaggacgtgatcttccgcgaagcgggcctggcgagccgcaacctgcgctgggaacgc
cgctaccggcagctgcattgggcgggctacggcctggtgacagcggccttcgtggccttg
atcggggggtgggcgatgagctatcgcaacaacgccgattacgtggaggaagtggcgcgg
cgcgtacccgcagtggagaagctgacgcgcgacatcaagatcacgcgcaccggcgacctg
ctgggactgatgcccttcctggacagcctctggtacctgccgcagcatgaaggcttcgag
atcgacaacccgccgctgagctatcgctatggcctctaccagggccagaaactgcaggcg
gcggcgcagggcgtgtacggcaacaccctggaccaggtgctgctgccgcaagtggcgcgg
cgcgtcgagaccgcgttgcgcgacgcctcggccagcgacctggaatattcctacgaggcg
ctgcgggcctatctgatgctgtacgaggcggagcgctatgacgcggagttcatgcatgcc
tggctgctgtcggacatgcaggccaccttgcccgagggctacacgcggcgccagtacgaa
cagttgtcgctgcacctgcgcaacctgacgcagagccatgtgctggcctcgccgtttccc
aaggatgacgcgttggtggcacaggcgcgcgagaagctggcgcgctacacgctggcgcaa
cgcgcctacagccggctgcgccgcaccctggccaacgccgatgcggcgcccgagatcacg
gtggtgacgctgggcggcgcgcaggccagcgccgtctttgtgcgcaagagcggcaagccg
ttgagccagggcatacccgcgctctacagctatcgcggctactgggacgtgttcaacaag
cgcgtcaccggcgtggccgaggtgctgcggtcggacgatgcgtggatcttgaacataccc
ttgcgcagccagctggaccagacggcgcaacgccagctggtggtggacatcaagcgcttg
tacatgaacgactacgtggcgcagtgggacggctatctgaacgatctgcagctggcgccc
agcaaatcgctgctgcagaacatccagatggcgcgcaccttgtcggcgccggagtcaccg
ctggtgcggctggtgcgcggcgtcgcgcgcgaaacctccttgctgcgcgataccggcaag
gacgaccgttcgctggtggatcaggcgcgcgaccgcgtcagcagcacgcgcgaggcgctg
gagcagatgttcgggccgaccgggccgggcgcggccatgcgggccgacgccagtgacgag
aagctggagcgcatcgtggaccagcacttcgaaccctaccgccggctggccgaaggcgag
ggcgcgacggccggcgctgcttctccgatcgccgcaaccacgggcctcatcaacgaactc
tatacctatctgacggcggcggacgcggccttgcgcagcggcagtcccgcgcccagttcg
gatgccgtgaccaagctgcgggcggaggcgggacgcctgcccgggccgttgcgcgacgtg
ctcaattccctgtccgtgaacgcgtccggcgaggtgtccgacgtggcccgggcgcgcatg
ggcgagaccgtgtccgccaccataggcatgttctgcagccagtccgtggccggacgctac
ccgttttccggccgttccacgcgcgacgtggcgcccaacgacatggcgcggctgttcggg
cccaacggcctgatggacgacttcttccagaagaacctggcgaaccagatcgatgtgtcc
ggacagcgctggcgcttcaagcccggcatcgatggcaagtcgggggagaactccggcacg
ctggatgccttccagcgcgccggcgtcatccgcgacgtgtacttcatggcgggcaacccc
atgccctcgtaccgggtggccatcaggcccgtggaaatggacgcggacattacccagttc
gtgatggacgtggacggccaggcggtgcgctacgcgcacggcccgcaggtcgcgaccacg
gtgcagtggcccggcccccgcggcagcaaccaggtgcgcatagagcttacgccgcaggaa
ggggcggcgggcatgaccacatccggcccctgggcgctgaaccgcatgctggatcgcgcc
caactgcggcgcggcgccacggcggaaatcacgctggccacattcgacctgggcgggcgc
aaggtggtgctggagatcaccgccagcagcgtcaaaagcccttttcatctggccgagatg
caggcctttgcctgccccggcgcgtcatga

DBGET integrated database retrieval system