KEGG   Achromobacter xylosoxidans A8: AXYL_06385
Entry
AXYL_06385        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:axy02044]
    AXYL_06385
Secretion system [BR:axy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AXYL_06385
SSDB
Motif
Pfam: T6SS_VasE DUF5821
Other DBs
NCBI-ProteinID: ADP19678
UniProt: E3HRQ9
Position
complement(6865322..6866656)
AA seq 444 aa
MVSRDKVIWSEGMFLRPQHFQQFERHMLHTAQQRAAALQGFFWGFSQLSLDRDALAIGKV
ALTRAQGVMPDGTPFDFSHPDAAPAAFEVPAQTRGARILLALPRVRAGASDVIYEGEEDT
LARYLVHEAEVEDSGSVALEPVLMQLGRLRLRLMLEDELTDDWLGLGVARILERRSDNRV
VLDEGYIAPWVAAGEHPVLRGFVDELHGLLDARSEALAARLSQPGRGGVSEVSDFMLLET
VNRYMGSVWHARQSPAQHPERLFHDWLMLACDLATFTSATRRPGVLPGYAHDDLQGSFTP
LMNELRRSLSAVLEQRALQIPLQDRGQGVRVAQIQDAELLQSAGFVLAVHADLGVEAVRM
RFPAQVKIGPVERIRDLVHLQLPGVAVRALPVAPRQIPYSAGHVYFELDKSGEFWKQLER
TGALALHLAGDFPGLTMEFWALRD
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggtgagcagagacaaagtgatctggtcggagggtatgttcctgcggccccagcatttc
cagcagtttgaacgccatatgctgcacaccgcgcagcagcgcgcggccgcgctccagggg
ttcttctggggcttcagccagctgtcgctggaccgcgacgcgctggcgataggcaaagtg
gcgctgacgcgggcgcaaggcgtcatgcccgatggcacgccattcgatttttcgcacccg
gacgcggcgccggcggcgttcgaagtgccggcgcaaacgcgcggcgcgcgcatcctgctg
gccctgccgcgcgtgcgcgccggcgccagtgacgtcatctacgaaggcgaggaagacacg
ctggcgcgctatctggtgcacgaggccgaggtggaggacagcggatcggtggccctggaa
cccgtcctgatgcagctgggccgcttgcgcttgcggctgatgctggaggacgagctgacc
gacgactggctgggcctgggtgtggcgcgcatcctggagcgccgctcggacaaccgagta
gtgctggacgagggctacatagcgccctgggtggcggcgggcgagcatccggtcctgcgc
ggctttgtcgatgaattgcacggattgctcgacgcgcgcagcgaggcgctggccgcgcgc
ttgtcgcagcccggccgcggcggcgtctccgaggtgtcggacttcatgctgctggagacc
gtcaaccgctatatgggctcggtctggcatgcgcgccagagccccgcgcagcatcccgag
cgcctgttccacgactggctgatgctggcctgcgacctcgccaccttcacatccgcgacg
cggcggccgggcgtattgccggggtatgcgcacgacgatctgcagggcagcttcacgccc
ctgatgaatgagctgcgtcgttcgttgtcagccgtgctggagcaacgtgccttgcagatt
ccgctgcaggaccggggccaaggcgtgcgcgtggcgcagatccaggatgcggagctgttg
cagtcggccggcttcgtgctcgcggtgcatgcggatctgggcgtggaggccgtgcgcatg
cgctttccggcgcaggtcaagatcggtccggtggaacgcatccgagacctggtgcacctg
caattgccgggcgtcgccgtgcgtgcgctgccggtggcgccgcggcagatcccatacagc
gccggacatgtctatttcgaattggataagagcggcgaattctggaaacagctggagcgc
accggcgcgcttgcgctgcatctggcgggcgattttcccgggctgacgatggagttctgg
gcgctgcgcgattga

DBGET integrated database retrieval system