KEGG   Achromobacter xylosoxidans A8: AXYL_06388
Entry
AXYL_06388        CDS       T01341                                 

Definition
(GenBank) FHA domain protein
  KO
K07169  FHA domain-containing protein
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    AXYL_06388
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-ProteinID: ADP19681
UniProt: E3HRR2
Position
6867753..6868514
AA seq 253 aa
MKLIVFQRAGDPAFDPIHAVFTAPGATIGRSLDNHLALPDPTRAICRVQAAIRVNDADAG
FVLNLSSMSAVSVNGQALARDQEVPLNPGDELQIGDYRLRADTGASEAAVAATSVVADDD
IFSDLIGPGTLPVGSAPDVSTHPFDLDSAQARNPEDPLRHLPPGDGAVASALTDPLALFD
APGDGTPSIFSDGTPSALPADDALAEHRAHPVDDALGRPRESADHRSASDHLREIGGYLR
PAPVKPEPGGQDR
NT seq 762 nt   +upstreamnt  +downstreamnt
gtgaaactcatcgtgttccagcgtgccggcgatccggccttcgaccccatccacgccgtg
ttcacggcgcccggcgccacgataggccgcagtctcgacaatcacctggccctgcccgat
cccacgcgcgccatctgccgcgtgcaggcggcgatccgcgtcaacgacgcggacgccggc
tttgtgctgaacctgagcagcatgagcgccgtcagcgtcaatggccaggcgctcgcgcgg
gaccaggaagtgccgctgaatcccggcgacgaattgcagatcggcgattaccggctgcgg
gcagatacgggcgcgtccgaagcggcggtagccgctacgtccgtggtcgccgacgacgac
atcttcagcgacctgatcggcccgggcaccttgcccgtgggcagcgcgccggacgtctcc
acgcatcccttcgatctggactccgcccaggcgcgcaatccggaagaccccttgcgccac
ctgccgcccggcgatggcgcggtggcgagcgcgctcaccgatcccctggcgctgttcgac
gcgcccggcgatggcacgcccagcatcttctcggacggcaccccgtccgccctgcccgcc
gacgatgcgctggccgagcaccgcgcccatcccgtcgatgatgccttgggccgtccgcgc
gagtccgcggaccatcgcagcgcatccgaccatctgcgggagatcggcggctacttgcgg
cccgcgcccgtcaagccagagcctggcggccaagaccgctga

DBGET integrated database retrieval system