KEGG   Achromobacter xylosoxidans A8: AXYL_06392
Entry
AXYL_06392        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:axy02044]
    AXYL_06392
Secretion system [BR:axy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AXYL_06392
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ADP19685
UniProt: E3HRR6
Position
complement(6872912..6874816)
AA seq 634 aa
MDDRLLDYYNRELVYLRELGAEFAQAHPKVAGRLGMNATEVADPYVERLLEGFSFLTARI
HMKMDAEFPRFSQRLLEVVYPNYLAPTPAMAIVQFAPSMNEGTLAGGFELPRGTLLRGRV
ARGEQTPCDFTTGHALRLWPLQVTQAEFTAAPQDLPLARLGLTGRTARVLSALRIRIEVC
GGQRLEDLDLDQLVFHLNGQDLQMQRLLEVVMGHTVAVLGHDAARPLAWINRLPPGAVRH
EGFADEQALLPGDARVFQGYRLLQEYFAFAQRYLFFSINGLKRGLRTPAMPQGAQRETRA
FDLTLLFSMAAPELEGAISAANLALHCAPVINLFAKRADRVAVTPRTSEYHVVIDRSRPL
DYEVYGVTRVAGHASAQRQEQEFRPFYGSLGSDPDEHGAYFSVRREARLVSDIAQRNGTR
SGYIGSEVFLSLVDRREAPFSGDLRHLTLETLCTNRDLALLLPLGTETDMTLRVSAPVRS
VKVLHGPTRPRAALAENAATWHLISHLGLNYLSLTDLDAEQGAQTLREMLHVYGSLAEPA
TRRHIAGLRHVSATPVHHRLPVPGPIVHGRGVRIALQVDETAFSGISPYLFGAVLEQFFA
RHVSINLMSELVLSSLQRGEIARYQPRMGRRPVV
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggacgatcgcctgctggattactacaaccgggaactggtctatctgcgggagctgggc
gcggaattcgcgcaagcccatcccaaggtggccggacgcctgggcatgaatgcgaccgag
gtggccgatccctatgtcgagcgcttgctggagggcttcagctttctgactgcccgcatc
catatgaagatggatgcggaatttccgcgtttctcgcaacggctgctggaggtggtgtac
cccaactacctggcgcccacgccagcgatggccatcgtgcagtttgcgcccagcatgaac
gagggcaccttggcgggaggcttcgagctgccacgcggcacgttgctgcgcggccgcgtg
gcgcgcggcgagcagacgccctgcgacttcaccaccggccacgccctgcgcctgtggccc
ctgcaggtcacgcaggcggagttcacagccgcgccgcaggatctgccgctggcgcgcctg
ggtctgacggggcgcaccgcgcgggtgctgagcgcgctgcgtatccggatagaggtatgc
ggcggacaacggctggaagacctggatctcgatcaactggtgtttcacttgaacggccag
gacctgcagatgcagcgcctgctggaagtcgtgatggggcataccgtggcggtgctgggc
catgacgccgcacggccgctagcctggatcaacaggctgcccccgggcgcggtgcgccat
gaaggctttgccgacgagcaggcgctgttgccgggcgacgcgcgcgtgttccagggctac
cggctgctgcaagagtacttcgcgttcgcgcagcgctatctgttcttcagcatcaacgga
ctgaagcgggggctgcgcacgcccgcgatgccccaaggcgcgcagcgcgagacccgcgca
ttcgacctgaccctgttgttctcgatggcggcgccggaactggagggcgcgatatcggcc
gccaatctggcgttgcattgcgcgccggtgatcaacctgttcgccaagcgggcggaccgc
gtggcggtaacccccaggacttccgagtaccacgtggtcatcgaccgcagccgcccgctg
gactacgaggtctacggcgtgacgcgcgtggcgggccacgcttccgcacagcgccaggag
caggagttccggccattctatggctcgctgggcagcgatcccgacgagcacggcgcctac
ttttccgtgcgccgcgaggcgcggctggtttcggacattgcgcagcgcaacggcacccgc
agcggctacatcggcagcgaggtgttcctgtcgctggtggaccggcgggaagcgccgttt
tccggtgacctgcgccacctgaccctggaaaccctgtgcaccaaccgcgatctggcgttg
ctgctgccgcttgggaccgagaccgacatgaccctgcgcgtgtcggcgccggtgcgctcg
gtgaaggtgctgcacggacccacgcggccgcgcgctgcgctggcggagaatgccgcgacc
tggcatctgatcagccacctgggcctgaactacttgagcctgactgacctggacgcagag
cagggcgcgcaaaccctgcgcgagatgctgcacgtctacggcagcctggccgagcccgcc
acgcgccggcacatcgccggcctgcggcatgtcagcgccacgccggtgcatcatcgcctg
ccggtgccaggccccatcgtccatgggcgcggcgtgcgcattgcgctgcaggtggacgag
acggcgttttcgggcatcagcccctatttgttcggcgccgtgctggagcagttcttcgcg
cgccacgtatcgatcaatctgatgtcggagctggtcctctcgagcctgcagcgcggtgag
atcgcccgctaccagccccgcatgggacgccggcccgtggtctag

DBGET integrated database retrieval system