KEGG   Achromobacter xylosoxidans A8: AXYL_06397
Entry
AXYL_06397        CDS       T01341                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
axy  Achromobacter xylosoxidans A8
Brite
KEGG Orthology (KO) [BR:axy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:axy02044]
    AXYL_06397
Secretion system [BR:axy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AXYL_06397
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: ADP19690
UniProt: E3HRS1
Position
complement(6878269..6878820)
AA seq 183 aa
MATSLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSETPQPEVG
ERKFLDIDIDNFDERMRSIQPRVAFQVPNTLTGEGNLNVDVTFESIDDFSPATVARKVGA
LNELLSARTQLANLLTYMDGKTGAEELIGSVLKNPALMNALAAAPKPQEEPRASDAPATD
PAA
NT seq 552 nt   +upstreamnt  +downstreamnt
atggcgaccagcctgaagggaagcggccagaagttcattgcaagaaaccgcgcgccgcgg
gtgcagatcgagtacgacgtggagatttacggcgcggagcgcaagatccagctgccgttc
gtgatgggcgtgctggcggatctggccggcaagtccgaaacgccgcagccggaggtgggc
gagcgcaagttcctggacatcgatatcgacaacttcgatgaacgcatgcgttccatccag
ccgcgcgtggcgttccaggtacccaacacgctgacgggcgaaggcaatctgaacgtggac
gtcacgttcgagagcatcgatgatttctcgcccgctaccgtcgcccgaaaagttggcgcg
ctgaacgaattgctgagcgcgcgcacgcagttggcaaacctgttgacgtacatggacggc
aagaccggcgccgaggaactgatcggcagcgtgctcaagaacccggcgctgatgaacgcg
ttggcggcggcgccgaagccgcaagaggagccgcgcgcatccgacgcccctgccacggat
cccgccgcctga

DBGET integrated database retrieval system