KEGG   Achromobacter xylosoxidans A8: AXYL_06408Help
Entry
AXYL_06408        CDS       T01341                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy00860  Porphyrin and chlorophyll metabolism
axy01100  Metabolic pathways
axy01110  Biosynthesis of secondary metabolites
axy01120  Microbial metabolism in diverse environments
Module
axy_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:axy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AXYL_06408 (hemB)
Enzymes [BR:axy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     AXYL_06408 (hemB)
Exosome [BR:axy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXYL_06408 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADP19701
UniProt: E3HRT2
Position
6892502..6893518
Genome map
AA seq 338 aa AA seqDB search
MNPQIISPEFPVSRPRRLRRDDFTRRLVRENALTVNDLIYPVFVAEGTGLQQAVPSLPGV
VRYSLDTLLPVARECVELGIPVLALFPAIDPSLKTPDGIEATNPNGLIPRVVRELKKQVP
ELGILCDVALDPYTSHGQDGVIDENGYVINEATVEILVKQALTQAEAGVDMVAPSDMMDG
RIGAVRRALEAKGHIHTQIMAYSAKYASAFYGPFRDAVGSATNLGKSNKMAYQMDPGNLD
EALREVAADLQEGADMVMVKPGMPYLDVLRRVKDTFRVPTFAYQVSGEYAMIKAAAANGW
LDHDKVMMEALLAFKRAGADGILTYFAIEAAKLLKSQR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgcagatcatctcccctgaattcccggtatcccgcccgcgccgcctgcgccgc
gacgacttcacccgccgcctggtgcgcgagaacgcgctgacggtcaacgatctgatctat
cccgtgttcgtggccgaaggcaccggcctgcagcaagccgtgccgtccctgccgggcgtg
gtccgctactcgctggacacgctgctgcccgtggcccgggaatgtgtggaactgggcatt
cccgtgctggcgctgttccccgccatcgatccctcgctcaagacgcctgacggcatcgaa
gccaccaaccccaatggcttgatcccgcgcgtggtgcgcgaactgaagaagcaggtcccc
gaactgggcatcctgtgcgacgtggcgctggacccgtacaccagccatggccaggatggc
gtcatcgacgagaacggctacgtcatcaacgaagccacggtggaaatcctggtcaagcag
gcgctcacgcaggccgaggccggcgtcgacatggtcgcccccagcgacatgatggatggc
cgcatcggcgccgtgcgccgcgcgctggaagccaagggccacatccacacgcagatcatg
gcctactccgccaagtacgccagcgccttctacggcccgttccgcgatgccgtgggctcg
gccacgaatctgggcaagtccaacaagatggcttaccagatggacccgggcaacctcgac
gaagcgctgcgcgaagtcgcggccgacctgcaggaaggcgccgacatggtcatggtcaag
cccggcatgccgtatctggatgtgctgcgccgggtcaaggacacgttccgcgtgccgacc
ttcgcctaccaggtcagcggcgaatacgccatgatcaaggccgccgccgccaacggctgg
ctggaccacgacaaggtcatgatggaagcgctgctggcgttcaagcgcgccggcgccgac
ggcatcctgacgtacttcgcgatcgaagccgcgaagctgttgaaaagccagcgctaa

DBGET integrated database retrieval system