KEGG   Achromobacter xylosoxidans A8: AXYL_06539
Entry
AXYL_06539        CDS       T01341                                 
Name
(GenBank) type IV secretion/conjugal transfer ATPase, VirB4 family protein
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
axy  Achromobacter xylosoxidans A8
Pathway
axy02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:axy00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AXYL_06539
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:axy02044]
    AXYL_06539
Enzymes [BR:axy01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     AXYL_06539
Secretion system [BR:axy02044]
 Type IV secretion system
  Trb secretion system protein
   AXYL_06539
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 ABC_tran
Other DBs
NCBI-ProteinID: ADP19828
UniProt: E3HXM4
Position
pA81:4225..6783
AA seq 852 aa
MIEAIAIGIAVLGAVLLLILFARIRQVDAELKLKKHRSKDAGLADLLNYAAVVDDGVIVG
KNGSFMAAWLYQGDDNASSTEEQREMVSFRINQALAGLGSGWMVHVDAVRRPAPNYSERG
VSTFTDPVSAAIDEERRRLFEGLGTMYEGHFVFAVTWFPPVLAQRKFVELMFDDDAVTPD
HTARTVGLIEQFKREIRSLESRMSSAVKLTRLKGHKIATEEGREVTHDDFLSWLQFCVTG
NYHPVQLPSNPMYLDAVIGGQELWGGVVPKIGRKFIQVVSLEGFPLESTPGLLSALAELP
SEYRWSSRFIFMDQHESLKHLDKFRKKWKQKIRGFFDQVFNTNTGSVNQDAATMVADAEA
AIAEVNSGLVAAGYFTSVVVLMDEDRERLAAAALSVEKAINRLAFAARIETINTMDAYLG
SLPGHGVENVRRPLINTMNLADLLPTSSIWTGSATAPCPMYPPLAPALMHCVTVGATPFR
LNLHVRDLGHTFMFGPTGAGKSTHLGIIAAQLRRYAGMSIYAFDKGMSMYPLAAAINAGS
KGKTGLHFTVAADDDRLAFCPLQFLETKADRAWAMEWIDTILALNGVDTTPGQRNEIGHA
IMSMHASGARTLSEFSVTIQDEAIREAIKQYTVDGSMGHLLDAEEDGLSLSDFTVFEIEE
LMNLGEKFALPVLLYLFRRIERGLKGQPAVIILDEAWLMLGHPAFRAKIREWLKVLRKAN
CLVLMATQSLSDAANSGILDVIVESTATKIFLPNVYARDEDTAALYRRMGLNKRQIEILA
TAVPKRQYYYVSENGRRLYDLALGPLALAFVGASDKESVAAIKSLQAKFGHEWVDHWLAG
RNLNLNDYLEAA
NT seq 2559 nt   +upstreamnt  +downstreamnt
atgatcgaagcaatcgcaattggcattgctgtactcggtgcggttctgttgctcatcctc
tttgcccgtatccgtcaggtcgatgccgagctgaagctcaagaagcatcggtcgaaggac
gcgggcctggccgacttgctcaactatgccgccgtggtcgatgacggcgtgatcgtgggc
aagaacggctcctttatggccgcctggctgtaccaaggggatgacaacgccagcagcacc
gaagagcagcgggaaatggtgtccttccgcatcaaccaggccctggcgggcctgggcagc
ggctggatggttcatgtcgatgccgtgcgccggccggcacccaactactccgagcgcggc
gtctccaccttcaccgatccggtgtcggccgccattgatgaagagcgccggcggctcttc
gagggcctgggcacgatgtacgaagggcacttcgtattcgccgtgacctggtttccgcca
gtgctggcccagcgcaagttcgttgagctgatgtttgacgatgacgcggtgacgcccgac
cacacggcccgcaccgtgggcctcatcgagcagttcaagcgcgaaatccgcagcctggaa
tcgcgcatgtcctcggccgtcaagctcacgcgcttgaagggccacaagatcgccacggaa
gagggcagggaagtcacgcatgacgacttcctgagctggttgcagttctgcgtgaccggc
aactatcacccggtgcagctccccagcaacccgatgtacttggacgccgtgatcggcggg
caagagctgtggggcggcgtcgttccgaagatcggccgcaagttcatccaggtggtgtcc
ctcgaaggcttccccttggagtcaacgcctggcctgctgtcggccctggccgagctgccg
agtgaataccgctggtcgagccgcttcatcttcatggatcagcacgagtccttgaagcac
ctggacaagttccgcaagaagtggaagcagaagattcgcggcttcttcgaccaggttttc
aacaccaacaccggcagcgtcaaccaggacgcggcaacgatggtggccgatgccgaggcg
gccatcgccgaggtcaatagcggcctggtggccgccggctacttcacgtccgtggtcgtg
ttgatggatgaggatcgggagcgcctggcggccgccgcgctgtcggtcgagaaggccatc
aaccggctggccttcgcggcgcgcatcgagacgatcaacacgatggacgcctacctgggc
agcttgcccggccacggcgtcgagaacgtgcgccggccgctcatcaacacgatgaacctg
gccgacctgctgccgacaagctccatctggacgggcagcgccaccgcgccgtgcccgatg
tacccgccgctggccccggcgctcatgcactgcgtcacggtcggcgctacgcccttccgg
ctgaacctgcacgtgcgcgacctgggccacaccttcatgttcggcccgaccggcgcgggc
aaatcgacgcacctgggcatcatcgccgcgcagctccggcgctatgccggcatgtcgatc
tacgccttcgacaagggcatgtcgatgtacccgctcgcggccgcaatcaatgccggctcg
aagggcaagactggcctgcacttcacggtggccgccgacgatgaccgcctggccttctgc
ccgctccagttcctcgaaacgaaggcggatcgggcttgggcgatggagtggatcgacacg
atccttgcgctcaacggcgtggacaccacgccagggcagcgcaacgagatcggccacgcg
atcatgagcatgcacgccagcggcgcgcgcacgctctccgagttctcggtgacgatccag
gacgaagcgatccgcgaggccatcaagcaatacacggtggacggctcgatgggccacctg
ctcgatgccgaagaggatggcctgtcgctctccgacttcacggtgttcgagatcgaagag
ctgatgaacctcggcgagaagttcgcgctgccggtgctgctgtacctgttccgccgcatc
gagcgcggccttaaaggccagccggccgtcatcatcctggacgaagcctggttgatgctg
ggccacccggcgttccgcgccaagattcgggaatggctcaaggtcttgcgcaaggcgaac
tgcctggtgctcatggctacgcaaagcctttccgacgcggccaactcgggcatcttggat
gtgatcgtggaatcgaccgcgaccaagattttcctgccgaacgtctatgcccgcgacgag
gacacggcggcgctctatcgccgcatgggcctcaacaagcggcaaatcgaaatcctcgcc
acggcggttccgaagcggcagtactactacgtctccgagaacggccgccgcctctatgac
ctcgccctggggccgctggccctggccttcgtcggcgcgtccgacaaggaatcggtcgcc
gccatcaagagcctgcaagcgaagttcggccatgagtgggtcgatcactggctggccggc
cgcaatctgaatctcaatgactacctggaggccgcatga

DBGET integrated database retrieval system