KEGG   Achromobacter xylosoxidans A8: AXYL_06545Help
Entry
AXYL_06545        CDS       T01341                                 

Definition
(GenBank) entry exclusion protein TrbK
Organism
axy  Achromobacter xylosoxidans A8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C DUF4148
Motif
Other DBs
NCBI-ProteinID: ADP19834
UniProt: E3HXN0
Position
pA81:11126..11347
Genome map
AA seq 73 aa AA seqDB search
MRLSKPSILAAAALVAALLAGCEKKPEPVTLPEVNAENCKPENIAKLDKSVQEAFSSQCL
RAGSFKPSEPKSW
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctatccaaaccctcgatcctggcagcggccgcccttgtggcggccctgctggcc
ggctgcgagaaaaagcccgagccggtgacgctgcccgaagtgaatgccgagaactgcaaa
cccgagaacatcgccaagctcgataagagcgtgcaagaggcgttttcatcgcagtgcctg
cgggccggctcgttcaaacctagcgaacctaagtcctggtga

DBGET integrated database retrieval system