KEGG   Ilumatobacter coccineus: YM304_08620Help
Entry
YM304_08620       CDS       T02501                                 

Definition
(GenBank) putative zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
aym  Ilumatobacter coccineus
Pathway
aym00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:aym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    YM304_08620
Enzymes [BR:aym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     YM304_08620
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     YM304_08620
    1.1.1.-  
     YM304_08620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Asp_decarbox
Motif
Other DBs
NCBI-ProteinID: BAN01176
UniProt: M4ZYE9
Position
complement(963395..964432)
Genome map
AA seq 345 aa AA seqDB search
MYAALITGKETVELVEFPDPTPPDAGVVVDIAFCGICGTDIHAYQSGTPYRPSICGHEWS
GTVSATGKAVRSLTEGDRVVVAASPACGRCSACEAGLADRCEAAFLSAIGSDPLAPPHGG
FAPRIAVAESRVVKTDSGLTDEQAAQVEPATVAFHAVRQSYLRLGDTAVIQGAGPIGLGT
MQWVRAAGAGRVIVIEPNAERRALALALGATDVVEPGDEASTLIKESTHGLGADIVYECV
GRAWAIQTAVDLARRGGSICLIGVPDTDATISPAVWLVKEIRMTAALAYFHEEFDMAMRM
MADGRVLVEPLHTSTASLAGLGDAIADLAGGATQQAKVLVNPNWA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcggcactgatcaccggcaaggaaaccgtcgaactcgtcgagttccccgatccc
actccccctgacgccggcgtcgtcgtcgacatcgccttctgcggcatctgcggcaccgac
atccacgcgtaccagtcgggcaccccgtaccgcccgtcgatctgcggccacgaatggtcg
ggaaccgtcagcgccaccggcaaggcggtgcgctcgctcaccgagggcgaccgcgtggtg
gtcgccgcgtcgccggcctgcggccggtgttcggcatgcgaggccggcctcgccgaccga
tgcgaagccgccttcctgagcgcgatcggcagcgatccgctcgcgcccccgcacggcggg
ttcgcgccacgcatcgccgtcgccgagtcgcgcgtcgtcaagaccgactcgggcctcacc
gacgagcaggccgcgcaggtcgaacccgccaccgtcgcgttccacgccgtgcgtcagagc
tacctccgcctcggcgacaccgccgtcatccagggcgccggcccgatcggactcggcacc
atgcagtgggtccgcgccgcgggagccggacgtgtcatcgtgatcgaaccgaacgccgag
cgtcgagcactcgcgctggcactcggagcaaccgacgtggtcgaacccggcgacgaggcc
agcacgctgatcaaagaatcgacgcacgggctcggcgccgacatcgtgtacgaatgcgtc
ggccgggcctgggccatccagaccgccgtcgacctcgctcggcgcggcggctcgatctgc
ctcatcggcgtgcccgacaccgacgccacgatcagccccgccgtgtggctcgtgaaggag
atccgcatgaccgctgcgctcgcctacttccacgaggagttcgacatggcgatgcggatg
atggccgacggacgagtgctcgtcgaaccgctccacacgtcgaccgcgagcctcgccgga
ctcggcgacgcgatcgccgacctcgcgggtggggcgacacagcaggcgaaggtcctcgtc
aacccgaactgggcctga

DBGET integrated database retrieval system