KEGG   Ilumatobacter coccineus: YM304_11690Help
Entry
YM304_11690       CDS       T02501                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aym  Ilumatobacter coccineus
Pathway
aym00030  Pentose phosphate pathway
aym00480  Glutathione metabolism
aym01100  Metabolic pathways
aym01110  Biosynthesis of secondary metabolites
aym01120  Microbial metabolism in diverse environments
aym01130  Biosynthesis of antibiotics
aym01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YM304_11690 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    YM304_11690 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aym04147]
    YM304_11690 (zwf)
Enzymes [BR:aym01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     YM304_11690 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     YM304_11690 (zwf)
Exosome [BR:aym04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   YM304_11690 (zwf)
  Exosomal proteins of colorectal cancer cells
   YM304_11690 (zwf)
  Exosomal proteins of bladder cancer cells
   YM304_11690 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAN01483
UniProt: M4ZXT9
Position
complement(1301189..1302646)
Genome map
AA seq 485 aa AA seqDB search
MSEQPITTDVPYVDTAQIDPNQPEADALVLFGATGDLAKRKLFPSLYKLERSNTLDVPVI
GVARSDWTDDDFRTHARESIEAHVDDADDEIISSLSDRLDLIQGDYADEATWEELRDTLD
RHGSETAVFYMAIPPSIFPMVAEKLASVGLNERGRIVVEKPFGRDLDSAVELNQTLHSVF
PEDHIFRIDHYLGKEAVEDLLVFRFANTLLEPVWNRNYVRSVQVTMSETIGVEGRGSFYE
GVGAIRDVLQNHLLQVIALLAMEPPAGPDARFLQDEKAKVISAMRPIECSQMVRGQYVGY
RDEDGVADDSSVETFAAVRLEIDSWRWAGVPWYVRVGKGLAENATEAVIELREPPRMLFD
EAGSPPPERNLIRLRLGKNDGVTFALQAKTPGPSLDSQEVDVDVDFAAALGERQDAYERL
LGDALVGSLRRFARQDVVEGTWAIVQPALDEPGEIFPYFRDSWGPSEADNILEPGDHWYP
PSPAR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagcccatcacgaccgacgttccgtacgtcgacaccgcgcagatcgacccg
aaccagcccgaagccgacgcgctcgtgctgttcggcgcaaccggcgacctcgccaagcgc
aagctgttcccgtcgctctacaaactcgaacgctccaacacactcgacgtccccgtcatc
ggcgtcgcccgcagcgactggaccgacgacgacttccgcacgcacgcacgcgaatcgatc
gaggcccacgtcgacgacgccgacgacgagatcatcagctcgctgtcggaccggctcgac
ctcatccagggcgactacgccgacgaagccacctgggaagaactgcgcgacacgctcgac
cgccatggctcggagaccgcggtgttctacatggcgataccgccgtcgatcttcccgatg
gtggccgagaagctggcgtcggtcggcctcaacgaacgcggccgcatcgtggtcgagaag
ccgttcggacgcgatctcgattcggccgtcgaactcaaccagacgctgcactcggtgttt
cccgaagaccacatcttccgcatcgaccactacctcggcaaggaagccgtcgaagacctc
ctcgtgttccgcttcgcgaacacgttgctcgaacccgtctggaaccgcaactacgtccgc
agcgtgcaggtcaccatgtcggagacgatcggcgtcgagggtcgcggcagcttctacgaa
ggcgtcggcgccatccgcgacgtgttgcagaaccacctgctccaggtgatcgcgctcctc
gcgatggagcccccggcgggccctgatgcccgcttcctccaagacgagaaggccaaggtc
atcagcgccatgcgcccgatcgagtgctcgcagatggtgcgcggtcagtacgtcgggtat
cgagacgaagacggcgtggccgacgactcgtcggtcgagaccttcgccgccgtgcgcctc
gagatcgactcgtggcgctgggccggtgtgccctggtacgtccgcgtcggcaaggggctc
gccgagaacgcgaccgaagcggtgatcgaactgcgcgagccgccgcgcatgctgttcgac
gaggccggcagcccgccgcccgaacgcaacctgatccggctgcggctcggcaagaacgac
ggggtcaccttcgcgctccaggccaagacgcccggtcccagcctcgacagccaggaggtc
gacgtcgacgtcgacttcgccgcggcgctcggcgaacggcaggacgcgtacgagcgcctg
ctcggtgacgcgctcgtcggctcgctgcgtcgattcgcccgccaagacgtcgtcgaaggc
acgtgggcgatcgtgcagccggcgctcgacgagcccggcgagatcttcccgtacttccgc
gattcgtggggcccctcggaggccgacaacatcctcgagcccggcgaccactggtacccg
ccctcccccgcacgctga

DBGET integrated database retrieval system