KEGG   Ilumatobacter coccineus: YM304_16830Help
Entry
YM304_16830       CDS       T02501                                 

Gene name
gpgS
Definition
(GenBank) putative glucosyl-3-phosphoglycerate synthase
  KO
K13693  glucosyl-3-phosphoglycerate synthase [EC:2.4.1.266]
Organism
aym  Ilumatobacter coccineus
Brite
KEGG Orthology (KO) [BR:aym00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aym01003]
    YM304_16830 (gpgS)
Enzymes [BR:aym01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.266  glucosyl-3-phosphoglycerate synthase
     YM304_16830 (gpgS)
Glycosyltransferases [BR:aym01003]
 Others
  Glycosylglycerate
   YM304_16830 (gpgS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: BAN01997
UniProt: M4ZZP0
Position
1884140..1885045
Genome map
AA seq 301 aa AA seqDB search
MAGVRTFEVPDRLDDDEIARLLELKGDRTISVCLPCRDEAATVGPLISVIRSELIAKTGL
VDELIVLDDRSTDDTARVATHAGARVVSIDDVHVSHGEGFGKGNALWATLLVSHGDFVVW
CDGDVTSFEPDWVSKLLLPMLDDDSVGMVKALYHRPTKYGGGGRTTELVARPLMSRYFPE
LTGLAQPLSGEYAGRRSVLESLSFVQGWGVEMGLLIDIADRYGPEAIAQVDLGNRLHRHR
SLQSLSVQAAEVMATMLDRAGHPPGDGEVQQALIRADGTDVPLNLRSRPSLASLGLSRTS
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccggagttcggaccttcgaggtgcccgatcggctcgacgacgacgagatcgctcgt
ctgctcgaactgaagggtgaccgcaccatctcggtgtgcctgccgtgtcgcgacgaggcg
gccacggtcggcccgttgatcagcgtcatccgcagcgaactgatcgcgaagacgggtctc
gtcgacgaactgatcgtcctcgacgatcgcagtaccgacgacaccgcacgcgtcgccacg
cacgccggagcacgcgtcgtgtcgatcgacgacgtccacgtctcccacggcgaaggcttc
ggcaagggcaacgccctctgggcgacgctcctcgtgagccacggcgatttcgtcgtgtgg
tgtgatggcgacgtcacgagcttcgaacccgactgggtgtcgaagttgctgctcccgatg
ctcgacgacgactcggtcggcatggtcaaggcgctgtaccaccggccgaccaagtacggc
ggtggcggtcgtacgaccgaactggtggctcgccccctgatgtcgcggtacttccccgaa
ctcaccggactcgcccagccgctgtcgggcgagtatgcaggccgccgctcggtgctcgaa
tcgttgagtttcgtgcagggctggggcgtcgagatgggactgctcatcgacatcgccgac
cgatacggacccgaggccatcgcccaggtcgacctcggcaaccgactccaccgccaccgg
tcgctccaatcgctctcggtgcaggccgccgaagtgatggccaccatgctcgaccgtgcc
ggacatccgcccggcgacggcgaggtgcagcaggcgctcatccgcgccgacggaaccgac
gtcccgctcaatctccgctcgcgcccctcgctcgcctcgctggggttgagccgcacgtct
gcatga

DBGET integrated database retrieval system