KEGG   Ilumatobacter coccineus: YM304_21290Help
Entry
YM304_21290       CDS       T02501                                 

Definition
(GenBank) putative phosphatase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
aym  Ilumatobacter coccineus
Pathway
aym00361  Chlorocyclohexane and chlorobenzene degradation
aym00625  Chloroalkane and chloroalkene degradation
aym01100  Metabolic pathways
aym01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aym00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YM304_21290
   00361 Chlorocyclohexane and chlorobenzene degradation
    YM304_21290
Enzymes [BR:aym01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     YM304_21290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: BAN02443
UniProt: M5A0S3
Position
2357408..2358097
Genome map
AA seq 229 aa AA seqDB search
MSYDVVLFDFDHTLLDSDASLAGAFEQSMRSAGVVDAAAIAGHYADFDRINQALWRQVEA
QQISPNDVKVRRFEQLIEVLELDADAHEMADAFVEGLVACGELFDGAIDLLDDLAARSRL
GMVTNGIGRVQRGRLARLGLSDHFDAVVISGEVGASKPGPAIFDVTFEAMGVSDRSSVLM
VGDSLPSDILGAANAGIASAWFNPMGHQANPDIPATHEVRDLPEISPLV
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgagctacgacgtcgtcctcttcgatttcgaccacaccctgctcgactccgacgcatcg
ctcgccggtgcgttcgaacagtcgatgcggtcggctggagtcgtcgacgcggcggcgatc
gccgggcactacgccgacttcgaccgcatcaaccaggcgctgtggcgccaggtcgaagcg
caacagatcagcccgaacgacgtgaaggtccgccgcttcgagcaactcatcgaggtgctc
gaactcgacgccgatgcacacgagatggccgacgcattcgtcgagggcctcgtcgcctgt
ggcgaactgttcgacggcgcgatcgacctgctcgacgatcttgctgctcgcagccgtctc
ggcatggtcaccaacggcatcggccgcgtgcagcgcggtcgcctcgctcggctcgggctg
agtgaccacttcgacgccgtcgtgatcagcggtgaagtgggcgccagcaagccggggccg
gcgatcttcgacgtcacgttcgaagcgatgggggtgagcgaccggtcgagtgtgctgatg
gtcggcgacagcctgccgagcgacatcctgggcgctgcgaacgccgggatcgccagcgcc
tggttcaacccgatggggcaccaggccaaccccgacattcccgccacgcacgaggtgcgc
gacctaccggagatcagcccactcgtctga

DBGET integrated database retrieval system