KEGG   Ilumatobacter coccineus: YM304_35320Help
Entry
YM304_35320       CDS       T02501                                 

Definition
(GenBank) putative aromatic amino acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
aym  Ilumatobacter coccineus
Pathway
aym00350  Tyrosine metabolism
aym00360  Phenylalanine metabolism
aym00380  Tryptophan metabolism
aym01100  Metabolic pathways
aym01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    YM304_35320
   00360 Phenylalanine metabolism
    YM304_35320
   00380 Tryptophan metabolism
    YM304_35320
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aym04147]
    YM304_35320
Enzymes [BR:aym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     YM304_35320
    4.1.1.105  L-tryptophan decarboxylase
     YM304_35320
Exosome [BR:aym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YM304_35320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAN03846
UniProt: M5A626
Position
3974611..3976053
Genome map
AA seq 480 aa AA seqDB search
MTPDDFRRHGHEMVDWIADFLDGVGSERVFPDVSPGDVRSQLPEHPPTEPESFDAVMADL
EHIIVPGLTQWQHPGFFAWFPSNTSYPSILGELMAAGLGINAMAWATSPAATELETLMVD
WMHELLGLPARFHSQSEHGGGVIQGSASEATLVAMLAARWKVTNGDVNADGDTTRLVGYA
TSQAHSSIEKGFRIAGIGTDHLRVVEHDDSFAMRPESLRELIAADRAAGLTPFFVCATNG
TTSSMAFDPIEQIADVCERDEVWLHVDAAMSGIAALEPEYRWVNDGLDRVDSYSTNPHKW
MGINFDCNLFWTADRASLIGALSILPPYLQSAAAEAGAAIDYRDWQVPLGRRFRALKLWF
ALRTDGVEPTKQMIRRQVGWTQQLAALVGADDRFDIVAPHPLNLLCIARRGATIDESNAL
TDALIDAANATGTVLFTRTVLDGRSTLRVSIGASATTFDDVADAWQLLSELANSASSTPD
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgacacctgacgattttcgccgccacggccacgagatggtcgactggatcgccgacttc
ctggacggcgtcgggtcggaacgggtcttccccgacgtcagccccggcgatgtccggtcg
caactgcccgagcacccgccgaccgagccggagtcgttcgacgccgtcatggccgacctc
gaacacatcatcgtgccgggtctgacgcaatggcagcatcccggcttcttcgcgtggttc
ccgtcgaacacctcgtacccgtcgatcctcggtgagctcatggccgctggtctcggcatc
aacgcgatggcgtgggcgacctcgccggccgccaccgaactcgaaacgctcatggtcgac
tggatgcacgaactgctcggacttcccgctcggttccactcgcagagcgagcacggtggt
ggcgtgatccagggcagcgcgagcgaggccacgctcgtcgccatgctcgctgcacgctgg
aaggtgaccaacggcgacgtcaacgccgacggcgacacgacccgactcgtcggctacgcc
acctctcaagctcactcgagcatcgagaaggggttccgcatcgccggcatcggcaccgac
catcttcgcgtcgtcgagcacgacgactcgttcgcgatgcgccccgagtcgttgcgcgag
ctcatcgccgccgaccgcgccgccgggctcacgccgttcttcgtctgcgcgacgaacggc
accacctcgtcgatggcgttcgacccgatcgagcagatcgccgacgtgtgcgaacgcgac
gaggtgtggctccacgtcgacgccgccatgtccggaatcgccgcgctcgaacccgagtac
cgctgggtcaacgatgggctcgaccgcgtcgattcgtactcgaccaacccacacaagtgg
atgggcatcaacttcgactgcaacctgttctggaccgccgaccgcgcctcactgatcggg
gcgctgagcatcctgccgccctacctccagtcggcggccgccgaagcgggcgcagcgatc
gactaccgcgactggcaggtgccgctcggccgacggttccgagcgctcaagctctggttc
gcactccgcaccgacggggtcgagccaaccaaacagatgattcgccggcaggtcggttgg
acgcagcaactcgccgccctcgtcggcgccgacgaccgtttcgacatcgtcgcaccgcac
ccgctgaacctgctctgcatcgcccgccgaggcgcgaccatcgacgagtccaatgcgctc
accgacgccctcatcgacgccgccaacgcgaccggaacggtgctgttcacccgaacggtg
ctcgacggtcgctcgacgttgcgcgtgtcgatcggcgcctcagcgacgacgttcgacgac
gtcgccgacgcgtggcagctgctcagcgaactggcgaacagcgcgtcgtcgacacctgac
tga

DBGET integrated database retrieval system