KEGG   Azoarcus sp. KH32C: AZKH_0605Help
Entry
AZKH_0605         CDS       T02502                                 

Gene name
wcaG_rfaD
Definition
(GenBank) ADP-l-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00540  Lipopolysaccharide biosynthesis
aza01100  Metabolic pathways
Module
aza_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AZKH_0605 (wcaG_rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aza01005]
    AZKH_0605 (wcaG_rfaD)
Enzymes [BR:aza01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     AZKH_0605 (wcaG_rfaD)
Lipopolysaccharide biosynthesis proteins [BR:aza01005]
 Unusual sugar
  AZKH_0605 (wcaG_rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind KR
Motif
Other DBs
NCBI-ProteinID: BAL22951
UniProt: H0PRV9
Position
complement(674827..675774)
Genome map
AA seq 315 aa AA seqDB search
MYIVTGGAGFIGSNIVQGLNARGITDILVVDDLSDGHKCLNLADADIRDYMDKDDFLRRI
QAGEEFGTVEAVFHEGACSSTTEWDGRFVMGVNYEYSKTLLGWCVARGLPFLYASSASVY
GMGPNFRESREFERPLNMYAYSKFLFDCHLRPQLPGLKSQVAGLRYFNVYGPREQHKGSM
ASVAFHFNNQLNECGRLRLFDGCDGYGPGEQLRDFIHVDDVVAVNLWLLDNPQVSGIFNV
GTGRAQAFNAVARATINWHGGGGIDYIAFPDHLKGRYQSFTEADIGALRAAGYDKPFMPV
EDGVPRYLDWLAQRA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgtgaccggcggcgccggcttcatcggcagcaacatcgtgcagggcctcaac
gcccgcggtatcaccgacatcctcgtcgtcgacgacctcagcgacggccacaaatgcctg
aacctcgcggacgccgacatccgcgactacatggacaaggacgatttcctgcgccgaatc
caggccggcgaggagttcggcacggtcgaggcagttttccacgagggcgcatgctcctcg
acgacggaatgggacggccgcttcgtgatgggcgtgaactacgagtacagcaagacgctg
ctcggctggtgcgtcgcgcgcgggctgcccttcctgtacgcctcgtcggcctcggtctac
ggcatgggcccgaatttccgcgagtcgcgcgagttcgagcgcccgctcaacatgtacgcg
tactcgaagttcctcttcgactgccacctgcgcccccaactgcccggcctcaagagccag
gtcgcgggcctgcgctacttcaatgtctacggcccgcgcgagcagcacaagggcagcatg
gcgagcgtcgccttccacttcaacaaccagctgaacgaatgcggccggctgcgcctcttc
gacggctgcgacggctacggaccgggcgaacagctgcgcgacttcatccacgtcgacgac
gtcgtggcggtgaacctgtggctgctcgacaaccctcaggtgagcggcatcttcaacgtc
ggcaccggccgcgcccaggccttcaacgcggtcgcccgagcgacgatcaactggcacggt
ggcggcggcatcgattacatcgcattcccggaccacctcaagggccgctaccagagcttc
accgaagccgacatcggcgcgctgcgcgcggccggctacgacaagcccttcatgcccgtg
gaggatggcgttccgcgctacctcgactggctcgcgcaacgcgcgtga

DBGET integrated database retrieval system