KEGG   Azoarcus sp. KH32C: AZKH_0843Help
Entry
AZKH_0843         CDS       T02502                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00260  Glycine, serine and threonine metabolism
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01120  Microbial metabolism in diverse environments
aza01130  Biosynthesis of antibiotics
aza01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZKH_0843
Enzymes [BR:aza01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AZKH_0843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAL23180
UniProt: H0PXI8
Position
915548..916606
Genome map
AA seq 352 aa AA seqDB search
MTETAFPTPGYKLQFASDNTAGVCPEALAAFNDANRGFASSYGNDDATAAVCDKLRTLFE
RDAEIFFAFNGTAANSLALAAMCQSYQGVICSDTAHVATDECGAPEFFSNGAKLLLAPHR
HGKLTSAGVREVITRRSDIHYPRPKVVTLTQATELGTLYQQGEIAGIARLAHEQGLKVHM
DGARFANAVASLDVAPADITWRAGIDVLCFGGTKMGLPVGEAIVFFDKAMGEEFAYRCKQ
AGQLASKMRFLSAPWLAMLDNGVWLRHAAHANAMAQRLRDRIARLAGAEMLLPTEANGVF
INLPQPAIERLRAAGWVFYTFIGGGARFMCSWATTEEAVDDLAGDLAAALDG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagacagccttcccgacccccggctacaaactgcaattcgccagcgacaacacc
gccggcgtctgccccgaggccctcgcggccttcaacgacgccaaccgcggcttcgcgtcc
tcctacggcaacgacgacgcgaccgccgccgtctgcgacaagctgcgcaccctcttcgag
cgcgacgccgagatcttcttcgccttcaacggcaccgccgcgaactcgctcgcgctcgcc
gcgatgtgccagtcctaccagggcgtgatctgcagcgacaccgcccacgtcgccaccgac
gaatgcggcgcgccggagttcttctcgaacggcgccaaactgctgctcgcgccccatcgc
cacggcaaactcacgtcggccggcgtgcgcgaagtcatcacccgccgcagcgacatccac
tacccccgccccaaggtcgtcacgctgacgcaggcgacggagctcggcaccctctaccag
cagggcgagatcgcaggcatcgcgcgcctcgcgcacgagcagggcctgaaggtgcatatg
gacggcgcgcgcttcgccaacgcggtggcctcgctcgacgtcgcgcccgccgacatcacc
tggcgcgccggtatcgacgtgctgtgcttcggcggcaccaagatgggcctgccggtcggc
gaggcgatcgtgttcttcgacaaggcgatgggcgaggaatttgcctaccgctgcaagcag
gccggccaactcgcatccaagatgcgctttctctccgcgccctggctcgcgatgctcgac
aacggcgtctggctcaggcacgccgcgcacgccaacgcgatggcgcaacgcctgcgcgac
cgcatcgcgcgtctcgccggcgccgagatgctgttgccgaccgaagccaacggcgtcttc
atcaacctgccgcagccggcgatcgagcgcctgcgtgcagccggctgggtgttctacacc
ttcatcggcggcggcgcgcgcttcatgtgctcctgggcgacgaccgaagaagccgtcgat
gaccttgccggagatctcgccgcggcactggacggctga

DBGET integrated database retrieval system