KEGG   Azoarcus sp. KH32C: AZKH_1753
Entry
AZKH_1753         CDS       T02502                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
aza  Azoarcus sp. KH32C
Pathway
aza03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:aza00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZKH_1753
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:aza02044]
    AZKH_1753
Secretion system [BR:aza02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZKH_1753
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: BAL24066
UniProt: H0PSC7
Position
complement(1962638..1963408)
AA seq 256 aa
MTSPPSLFADAPSASLNDGTGTKPHSLVDLLYDGFHMLMLLHHQKTPKDAARFSESIQKF
LDDFERLAKKHDFDANDIFDAKYAFCAAVDESILASRINIRDDWERRPLQLALFGDQLAG
EHFFDKLERARNEGAARIAALEVFHLCLLLGFKGKYLLEGPEKLKYLIAQLGEQLLHLKG
KRAQFAPRWAAPDQIAHLLKWEMPIWGIGSLIALLGLLAYVGLAMQAESNTHASLAGYDG
LVQLTPRPPTLNITLP
NT seq 771 nt   +upstreamnt  +downstreamnt
atgacaagtcccccttccctgttcgccgacgccccaagcgcctcactcaacgacgggacc
ggtacgaagccgcatagcctggtcgatctcctgtacgacggatttcacatgctgatgctc
ctgcatcaccagaagacgcccaaggatgccgcgcggttcagcgagagcatccagaaattc
ctggacgatttcgaacgccttgcaaagaagcacgattttgacgcgaacgacatcttcgat
gcgaaatatgcattttgcgctgcagtggacgagtcgatcctggcgtcccgaataaacatc
cgtgacgattgggagcgtcgtccgctacagctggcgctcttcggcgatcagctcgccggc
gaacacttcttcgacaagctcgaacgcgcccggaacgagggtgccgcgaggattgcggct
cttgaagtgttccacctgtgcctactcttgggcttcaagggcaagtacctgctggaaggt
ccggaaaagctgaagtatctgatcgctcaactcggcgagcaactcctccacctcaaggga
aaacgcgcccagtttgcgccgcgttgggcggcgccggaccagattgctcatctgctgaag
tgggaaatgccgatctggggaatcggatcgctgattgccttgctcggcctgctcgcatac
gtcggcctcgcgatgcaggcggaaagcaatacacatgcgtcgctcgccggctatgacggc
ctggttcagctcacgccgcgcccgccgacactgaacatcacgcttccctaa

DBGET integrated database retrieval system