KEGG   Azoarcus sp. KH32C: AZKH_2139Help
Entry
AZKH_2139         CDS       T02502                                 

Gene name
bcrD
Definition
(GenBank) benzoyl CoA reductase subunit
  KO
K04115  benzoyl-CoA reductase subunit D [EC:1.3.7.8]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00362  Benzoate degradation
aza01100  Metabolic pathways
aza01120  Microbial metabolism in diverse environments
aza01220  Degradation of aromatic compounds
Module
aza_M00541  Benzoyl-CoA degradation, benzoyl-CoA => 3-hydroxypimeloyl-CoA
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZKH_2139 (bcrD)
Enzymes [BR:aza01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.8  benzoyl-CoA reductase
     AZKH_2139 (bcrD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BcrAD_BadFG Hydantoinase_A FtsA UIM
Motif
Other DBs
NCBI-ProteinID: BAL24450
UniProt: H0PZB7
Position
2418315..2419124
Genome map
AA seq 269 aa AA seqDB search
MFTAGIDMGSRSVKVVLLEEVAVEGVPGKQYSVKKAHLMMPGDLDADQAADKAFNEALSA
AGVTRDQVKAVFATGAGRTQVGFATEGVTEMTAGAKGAVFMYPQARTVVDVGAEEGRGIK
TDADGKAIDFAGNEKCAAGAGSFAEAMSRALQLSLKEFGEASLKSDKSIPMNAQCTVFAE
SEVVSLIHSATPKEDIAKAVLDAVASRVCAMVRRVGIEGNVVLIGGMGHNPGFVASLKNA
MDVDEVLLPELPEYVSALGCALIAAERVH
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtttaccgctggaatcgatatgggctcccgcagcgtgaaagtggtgctgctggaagag
gtggctgtggaaggcgtgccgggcaagcagtactcggtgaagaaggcgcatctgatgatg
ccgggcgacctggacgccgatcaggcagcagacaaggccttcaatgaggcgctgtcggca
gcaggcgtgacgcgcgatcaggtcaaggccgtgttcgcgaccggcgccggacgcacgcag
gttggtttcgcgaccgaaggcgtgaccgagatgacggccggtgcgaaaggcgcggtgttc
atgtatccgcaagcccgcacggtggtggacgtcggtgccgaggaaggccgaggcatcaag
accgacgccgacggcaaggcaatcgacttcgccggtaacgagaagtgcgccgcgggcgcg
ggttccttcgccgaggcgatgagccgtgcgctccagctctcgctaaaggagttcggcgag
gcgagcctgaagtcggacaagagcatcccgatgaacgcgcaatgcacggtgttcgcggag
tccgaggtggtgtcgctgatccactccgcgacgccgaaggaagacatcgcgaaggcggtg
ctggatgcggtggcgagccgggtgtgcgcgatggtgcggcgcgtcggcatcgagggcaac
gtggtgctgatcggtggcatgggccacaacccggggttcgtcgcgtcgctgaagaacgcg
atggacgtcgatgaggtgttgttgcccgaactgccggaatacgtcagcgccctcggatgc
gcgctgattgccgccgagcgtgtgcactga

DBGET integrated database retrieval system