KEGG   Azoarcus sp. KH32C: AZKH_2241Help
Entry
AZKH_2241         CDS       T02502                                 

Definition
(GenBank) phosphotransferase domain-containing protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
aza  Azoarcus sp. KH32C
Brite
KEGG Orthology (KO) [BR:aza00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AZKH_2241
Enzymes [BR:aza01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     AZKH_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: BAL24551
UniProt: H0PZL8
Position
2546323..2547159
Genome map
AA seq 278 aa AA seqDB search
MQINADLHCHSTVSDGWLTPTDVVRRAAANSVALLALTDHDEVGGIDEACGEALRLGVRL
LPGVEISVTFLKETVHVVGLGIDHRDRQLLEGLESVRSGRVQRARKMSAALDAAGIHGTF
EGASRLARNPAMVGRAHFARYIVSTGLMPDVSTVFQYYLARGKPGYVEHEWASLDDAVRW
IRGAGGVAVLAHPARYRLSTDELHRLLDRFVACGGEGIEVVAGAHTEAETVKFAAIARRW
GLLASRASDFHGEGESSVDLGRSSNLPPDLTPVWTRFV
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaatgcggacctccattgccactcgaccgtatcggatggttggctgacgcca
accgacgtcgtgcggcgagccgcggccaatagcgtggccctgctcgcgctgacggatcac
gacgaggtcggcggtatcgacgaggcatgcggcgaagcgctgcggctgggtgtgcgcctg
ctgcccggcgtcgaaatttcggtgaccttcctcaaggagaccgtgcatgttgtcgggctc
gggatcgaccatcgcgaccggcagctgctcgagggcctggaaagcgtacgcagcggacgt
gtgcagcgcgcaaggaagatgagtgcggcgctcgatgccgccgggattcacggcaccttc
gagggcgcatctcgcctcgcccgcaatccggcgatggtgggacgtgcccatttcgcccgg
tatattgtgtcgaccggtttgatgccggatgtgagtaccgtgttccagtattatctggcg
cggggtaagcccgggtacgtcgagcacgaatgggcgagcctcgacgatgccgttcgctgg
attcgcggcgcgggaggtgtggctgtattggcgcacccggcgcgctatcgcttgtcgacc
gacgagttgcatcgactgctcgatcgcttcgtcgcctgtggcggggaagggatcgaggtg
gttgcgggagcgcacaccgaggccgagacggtcaagtttgcggcaattgcccgccgttgg
ggactgctggcgtcgcgagcttccgacttccatggcgaaggcgagagttccgtcgatctg
ggccgcagcagcaatctgccgcccgacctgactcctgtctggacgcgattcgtctag

DBGET integrated database retrieval system