KEGG   Azoarcus sp. KH32C: AZKH_2336Help
Entry
AZKH_2336         CDS       T02502                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00071  Fatty acid degradation
aza00072  Synthesis and degradation of ketone bodies
aza00280  Valine, leucine and isoleucine degradation
aza00310  Lysine degradation
aza00362  Benzoate degradation
aza00380  Tryptophan metabolism
aza00620  Pyruvate metabolism
aza00630  Glyoxylate and dicarboxylate metabolism
aza00640  Propanoate metabolism
aza00650  Butanoate metabolism
aza00900  Terpenoid backbone biosynthesis
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01120  Microbial metabolism in diverse environments
aza01130  Biosynthesis of antibiotics
aza01200  Carbon metabolism
aza01212  Fatty acid metabolism
aza02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZKH_2336
   00630 Glyoxylate and dicarboxylate metabolism
    AZKH_2336
   00640 Propanoate metabolism
    AZKH_2336
   00650 Butanoate metabolism
    AZKH_2336
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AZKH_2336
   00072 Synthesis and degradation of ketone bodies
    AZKH_2336
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZKH_2336
   00310 Lysine degradation
    AZKH_2336
   00380 Tryptophan metabolism
    AZKH_2336
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZKH_2336
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZKH_2336
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZKH_2336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aza04147]
    AZKH_2336
Enzymes [BR:aza01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZKH_2336
Exosome [BR:aza04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZKH_2336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAL24642
UniProt: H0Q1P8
Position
complement(2650712..2651914)
Genome map
AA seq 400 aa AA seqDB search
MRDAVIVSVARTPIGKAYRGAFNNTQGQALAGHVVRAALDRAGVESDAVDDVVMGCAIQQ
GTTSFNVARQAALRAGLPVSVPGMTVDRQCGSGLMAIATAAKQIIVDGMNVAVAGGVESV
SLVQNEHYNMFRIQDPVLDERVPALYMSMLETAEIVSQRYGISRDRQDEYALRSQQRTAQ
AQAEGRFDGEIVPMESVMARFDKASGSTVFEAVTLDRDEGNRPQTTLEDLTKLEPVFKGG
QILKEGRYVTAGNASQLSDGAAALVLMEAGEAARRGLTPLGRYRGMAVAGCSPEEMGIGP
VLAVPKLLAQAGLKVEDIDLWELNEAFASQVLYCRDTLGIPDERLNVSGGAIAVGHPYGM
SGARMTGHILLEGRRRKAKYGVVTMCVGGGIGAAGLFEIF
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgcggtaatcgtttccgttgcccgcaccccgatcggcaaagcctatcgcggt
gccttcaacaacacccagggccaggccctcgcaggccacgtcgtgcgcgctgccctcgac
cgagccggggtcgaatccgacgccgtcgacgacgtcgtaatgggctgcgcgatccagcag
ggcaccacgagcttcaacgtcgcccgccaggccgccctgcgcgccggtctgccggtcagc
gtccccggcatgaccgtcgaccgtcaatgcggctccggcctgatggcgattgccaccgcc
gccaagcagatcatcgtcgacggcatgaacgtcgcggtcgccggcggcgtggaatcggtg
tcgctcgtgcagaacgagcattacaacatgttccgcatccaggacccggtgctcgacgag
cgcgtcccggcgctctacatgtcgatgctcgaaacggccgagatcgtctcgcagcgctat
ggcatcagccgcgaccgccaggacgaatacgccctgcgctcgcagcagcgcaccgcccag
gcccaggccgaggggcgcttcgacggcgagatcgtgccgatggaatccgtcatggcgcgc
ttcgacaaggcgagcggcagcaccgtgttcgaggcggtcaccctcgaccgtgacgaaggc
aaccgaccgcagacgacgttggaagacctcaccaaactggagcccgtcttcaagggcggg
cagatcctcaaggaaggccgctacgtcaccgccggcaacgcctcccagctctccgacggc
gccgcggcgctggtgctgatggaagcgggcgaagcggcgcgacgcggcctcaccccgctc
gggcgctatcgcggcatggcggtggccggctgcagccccgaggagatgggcatcggcccc
gtgctcgccgtacccaagctgctcgcgcaggcgggcctcaaggtcgaggacatcgacctg
tgggaactcaacgaggccttcgcatctcaagtgctgtattgccgcgacacgctcggcatc
cccgacgagcgcctcaacgtgtccggcggcgccatcgccgtgggtcacccttatggcatg
tccggcgcgcgcatgaccggccacatcctgctcgaaggccggcgccgcaaggccaaatac
ggcgtcgtgacgatgtgcgtcggcggtggcatcggcgccgccggactgttcgaaattttc
tga

DBGET integrated database retrieval system