KEGG   Azoarcus sp. KH32C: AZKH_2502Help
Entry
AZKH_2502         CDS       T02502                                 

Definition
(GenBank) putative AMP-dependent synthetase and ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00061  Fatty acid biosynthesis
aza00071  Fatty acid degradation
aza01100  Metabolic pathways
aza01212  Fatty acid metabolism
aza02024  Quorum sensing
Module
aza_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AZKH_2502
   00071 Fatty acid degradation
    AZKH_2502
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AZKH_2502
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aza01004]
    AZKH_2502
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aza04147]
    AZKH_2502
Enzymes [BR:aza01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     AZKH_2502
Lipid biosynthesis proteins [BR:aza01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   AZKH_2502
Exosome [BR:aza04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   AZKH_2502
  Exosomal proteins of breast cancer cells
   AZKH_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAL24808
UniProt: H0Q3S0
Position
complement(2826701..2828278)
Genome map
AA seq 525 aa AA seqDB search
MIDIQKSAEARRIGRIALGDIVHRSAQRAGARIAVIDGDERLTHAELDARSSQFAHFLCA
ALPKGGQVATLCENSAELVVAINGIHKAGAVWVPVNIKLDVAQIGYILRHAEVVGIVVDE
EVCLEPKMAALLTELGLPVVVTRATGKTSVSTMTFSDALHGRPDHLPEVDIDADQPALIM
YTSGTTGNPKGVVHSHGSVHHALIANIATFGYSHADVVTCMLPLFHCGQHNAGAAALAAG
ASLVIARGFNAGNLIADIVERRVSVIVGLPMMYGAVLAHPSARTADFSSLRLCVYAMAPM
SQELVAAISQTMCPNLMLATGQTEIYPVTMSYRPSLNDGRNANYWGVSSSIVETAVMDDE
GNLLPPGKVGEIVHRGPNVMLGYFKDPEATAAAQKFGWHHTGDIGKFDDGGQLQFLDRKK
DMIKTGGENVASIKVESAILGHAAVASVAVLGLPHPHWSEAICAVVVLKPDMPCGEAELD
AWCRERLGKFEVPKAIRFVEQLPVTATGKIRKQVLRSQFEGLFLG
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatattcagaagagcgcggaggccaggcgcatcggccgaatcgccctgggggac
atcgtgcatcgcagtgcgcaacgcgccggtgcgcgcattgcggtgatcgatggcgacgag
cgcctgacccacgccgaactcgatgcgcgcagttcgcagttcgcccatttcctctgcgcg
gccttgccgaaaggtggtcaagtcgcgaccctttgcgaaaattcggccgaattggtggtt
gccatcaacggcatccacaaggcgggcgccgtatgggtcccggtcaacatcaagctggat
gtggcgcaaatcggctacatccttcgccatgcggaagtcgtcggcatcgtcgtggacgag
gaggtttgcctcgagccgaagatggctgcgctattgaccgagctcggcctgccggtcgtc
gtcacacgcgctaccggcaagacctccgtctcgacaatgacgttttccgatgcgctccac
ggcaggcccgaccacctgccggaggtggacatcgatgccgaccagccagcgctgatcatg
tacaccagcggcaccacggggaatcccaagggcgtcgttcactcccacggctcggtgcac
catgccctgatcgccaacattgcgaccttcggctacagccacgcggacgttgtcacctgc
atgttgccgctgttccattgcggccagcataacgccggtgctgccgccctggcggcaggg
gcgagcctcgtcatcgcaagaggcttcaacgccgggaaccttatcgccgacattgtcgag
cggcgcgtttctgtgatcgtcggacttccgatgatgtacggggcggtcctggcccacccg
tcggcccggactgcggacttctcgtcgcttcgcttgtgcgtctatgcgatggcgccgatg
tcacaagagctcgttgctgcgatcagccagacaatgtgtccgaacctgatgcttgccacc
gggcagacggagatctacccggtcacgatgtcctatcgaccgtccctgaatgacgggcgg
aatgccaattattggggcgtttcgtcgtcgatcgtggagaccgccgtcatggatgacgag
gggaatctgctgccgcccggcaaggtcggcgagatcgtacatcgtggtccgaatgtgatg
ctcggctacttcaaggatcccgaggcaaccgccgcggctcagaagttcggctggcatcat
accggcgacatcggcaagttcgatgacggcggccaacttcagtttctcgatcgcaagaag
gacatgatcaagactggcggtgagaacgtggcgagcatcaaggtcgaatcggcgatcctg
ggtcacgcggccgtcgcgagtgttgcggtgctgggcctgccacatccgcactggagcgag
gcgatctgcgccgtggtcgtgctgaagccggacatgccgtgcggcgaagcggagctggac
gcctggtgtcgagagcgcttaggaaagttcgaggtgccgaaggccattcgcttcgtcgag
caattgccggtcactgccaccggcaagatacgcaagcaggtccttcgcagtcagtttgaa
ggtctatttcttggctga

DBGET integrated database retrieval system