KEGG   Azoarcus sp. KH32C: AZKH_2532Help
Entry
AZKH_2532         CDS       T02502                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00260  Glycine, serine and threonine metabolism
aza00620  Pyruvate metabolism
aza00630  Glyoxylate and dicarboxylate metabolism
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZKH_2532
   00630 Glyoxylate and dicarboxylate metabolism
    AZKH_2532
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZKH_2532
Enzymes [BR:aza01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     AZKH_2532
    1.1.1.81  hydroxypyruvate reductase
     AZKH_2532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 2-Hacid_dh Cellulase-like
Motif
Other DBs
NCBI-ProteinID: BAL24838
UniProt: H0Q3V0
Position
complement(2859417..2860343)
Genome map
AA seq 308 aa AA seqDB search
MSFLYKADPERGAVWARLFAERAPDIDFRIWPDIGNPSAVRYLAAWEPPENLAETFPNVK
VVFSVGAGVDQFDFSRIPPEVPVVRMIESGLVAGMVEYATLAVLAAHRDWLPYAAQQREG
VWNPIRVRTAGSRRVGVLGMGVLGQAVLAKLQGFGFQCAGWSRTARELPGIESYAGEEGM
DAFLARTDILVCLLPLTNATRGILSRDLFERLPPRSVLVNVGRGGHLVEQDLLDALDSGR
LSAAILDVFDTEPLPPGHPFWRHPRIMVTPHIASMTQPETAVEAVLENLRRHREGLPLIG
LVDRRQGY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagctttctctacaaggccgatccggagcgcggggccgtctgggcgaggctgttcgcc
gaacgggcacccgatatcgatttccgtatctggccggacatcggcaacccgtccgcagtg
cgctacctcgccgcctgggagccgccggagaacctggcggagacctttcccaacgtgaaa
gtcgtgttctccgtgggtgccggcgtcgaccagttcgatttttcgcgcatccctcccgag
gtgccagtggtgcgcatgatcgaatcggggctcgtggcaggcatggtcgagtacgcgacc
ttggccgtgctggccgcgcaccgcgactggctgccatacgccgcgcagcagcgcgagggg
gtgtggaacccgatccgggtgcgcacggcgggctcgcgccgggtcggcgtgctcggcatg
ggcgtgctcggccaggcggtgctcgcgaaactgcagggcttcggcttccagtgcgcgggc
tggagccggactgcgcgcgagctgccgggcatcgagagctacgccggcgaggagggcatg
gacgccttcctcgcccgcaccgacatcctcgtctgcctgctgccgctgacgaacgcgacg
cggggcattctttcgcgggacctgttcgaacggctgccgccgcgatcggtgctggtgaac
gtggggcggggcggccacctggtggagcaggacctgctggacgcgctcgacagcggacgc
ctgtccgcggcgatcctcgacgtcttcgacacggagcccctgccgccggggcacccattc
tggcgccacccgcgcatcatggtcacgccccacatcgcgagcatgacgcaacccgagacc
gccgtggaggcggtgctggaaaacctccgccggcatcgcgaagggcttccgctgatcggc
ctggtggaccgccgccaaggctattga

DBGET integrated database retrieval system