KEGG   Azoarcus sp. KH32C: AZKH_2688Help
Entry
AZKH_2688         CDS       T02502                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00030  Pentose phosphate pathway
aza00480  Glutathione metabolism
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01120  Microbial metabolism in diverse environments
aza01130  Biosynthesis of antibiotics
aza01200  Carbon metabolism
Module
aza_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:aza00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AZKH_2688
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AZKH_2688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aza04147]
    AZKH_2688
Enzymes [BR:aza01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AZKH_2688
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AZKH_2688
Exosome [BR:aza04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AZKH_2688
  Exosomal proteins of colorectal cancer cells
   AZKH_2688
  Exosomal proteins of bladder cancer cells
   AZKH_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAL24994
UniProt: H0PSQ2
Position
3042317..3043777
Genome map
AA seq 486 aa AA seqDB search
MAHPRTLDLVIFGGTGDLAMRKLLPALYHLHCDALLPAEARIVGVARDGLDDDGYRSFAR
THAERFIGKDFKPAEWAGFAERLVYAQVDALQADSFASLAERLNGRPDGQRVFYLSTAPS
LFTTITGHLHGAGLVAADSRVVLEKPLGHDLASSRQINDEVGRYFAEDQIYRIDHYLGKE
PVQNLLALRFGNALFEPLWRREWVRDVQITVAEQVGVEGRGEFYDRVGAMRDMVQNHLLQ
LLCIVAMEPPASIAPDAVRDEKLKILRALRPFGLADVATRTVRGQYKAGASGGQPVPGYL
EENGIPGDSRTETFVALKAEINTWRWAGVPFFLRTGKRMQEKVAEIVINFRSVPHSIFGV
PATPQHANRMVIRMQPEETVDLHLLAKQPGDVMQLHPVRLDLDFAEAFRTRRLEAYERLL
MDVMRGNLTLFVRRDEQEAAWRWVEPIMAGWQAADDRPKPYTAGTWGPAGSSALLSRDGL
SWHEEI
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcacacccccgtactcttgatctggtcatcttcggtggaaccggggatctcgcaatg
cgcaagctgctgcccgcgctttatcacctgcattgcgatgcactgctgcccgccgaggcg
cgtattgtcggcgtcgcgcgcgacgggctggacgacgacggctatcgcagctttgcccgc
acgcacgcagaacgcttcatcggcaaggatttcaagcccgccgaatgggcgggctttgcc
gagcgtctcgtgtatgcgcaggtcgacgcgctgcaggccgacagcttcgcctcgctcgcc
gaacggctgaacggccgcccggacggccagcgcgtcttctatctatcgaccgcgcccagt
ctgtttactacgatcaccggtcatcttcacggtgccgggctggttgcggcagacagccgc
gtcgtcctcgaaaagccgctcggccacgatctcgcctcctcgcgccagatcaacgacgag
gtcggccgctatttcgccgaggaccagatctaccggatcgaccattacctcggcaaggaa
ccggtgcagaacctgctcgcgctgcgcttcggcaacgcgctgttcgaaccgctgtggcgg
cgcgagtgggtgcgcgacgtgcagatcacggtcgcggaacaggtcggcgtcgaagggcgc
ggcgagttctacgaccgcgtcggcgcgatgcgcgacatggtgcagaaccacctgctccaa
ttgctgtgcatcgtcgcgatggagccgccggcgtcgatcgcgccggatgccgtgcgcgac
gagaagctgaagatcctgcgcgcgttgcgtcccttcggcctggccgatgtcgcgacccgg
accgtgcgcggtcagtacaaggccggggcgagcggcgggcagccggtcccgggctatctc
gaagagaacggcatcccaggcgacagccgtaccgaaaccttcgtcgcgctgaaggccgag
atcaatacctggcgctgggccggcgtgcccttcttcctgcgcacaggcaagcggatgcag
gagaaggtcgccgagatcgtcatcaacttccgctcggtgccgcactcgatcttcggagtc
cccgccacgccgcagcacgcgaaccgcatggtgatccgcatgcagccggaggaaaccgtc
gatctccacctcctcgcgaagcagccgggcgacgtgatgcaactgcacccggtgcgcctc
gacctcgactttgccgaggccttccgcacgcgccgcctggaagcctacgagcgcctgctg
atggacgtgatgcgcggcaacctgaccctgttcgtgcggcgcgacgagcaggaagcggcg
tggcgctgggtcgagccgatcatggccggatggcaggctgccgacgaccgtccgaaacct
tataccgcgggtacctggggcccggccgggtccagcgcgctgctctcgcgcgacggcctc
tcctggcacgaggagatctga

DBGET integrated database retrieval system