KEGG   Azoarcus sp. KH32C: AZKH_3538Help
Entry
AZKH_3538         CDS       T02502                                 

Gene name
thrS
Definition
(GenBank) threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:aza00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AZKH_3538 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aza01007]
    AZKH_3538 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aza03016]
    AZKH_3538 (thrS)
Enzymes [BR:aza01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     AZKH_3538 (thrS)
Amino acid related enzymes [BR:aza01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AZKH_3538 (thrS)
Transfer RNA biogenesis [BR:aza03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AZKH_3538 (thrS)
 Prokaryotic type
    AZKH_3538 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS LytR_C
Motif
Other DBs
NCBI-ProteinID: BAL25824
UniProt: H0Q2C5
Position
complement(3920390..3922306)
Genome map
AA seq 638 aa AA seqDB search
MPNITLPDGSVRSFDHPVTVLEVAASIGAGLAKAALAGKVDGRLVDASHSIEGDASLAII
TDKSEEGVDIIRHSTAHLLAHAVKELFPDAQVTIGPVIENGFYYDFSYKRPFTPEDLEKI
EKRMAELAKREIPVAREVWPRDKAVEFFKSQGENYKAEIIASIPQAEDVSLYRQGDFIDL
CRGPHVPSTGKLKVFKLTKLAGAYWRGDSKNEMLQRVYGTAWAKKEDLDGYLHMLEEAEK
RDHRKLGRLLDLFHLQEEAPGMVFWHAKGWTLWQQVEQYMRRTILENGYQEVKTPQIVDR
SLWERSGHWGMYSDLMFTTQSEKHDYAVKPMNCPCHIQIFNQGLKSYRDLPLRMAEFGSC
HRNEPSGSLHGIMRVRNFVQDDAHIFCAEDQVQAESAAFIELLQKVYADFGFTEILIKLS
TRPDKRVGTDEQWDAAEAALASALDAQGLAYELQPGEGAFYGPKIEFSLKDCLNRVWQCG
TLQLDFNLPVRLGAEYVAEDNAKKFPVMLHRAILGSLERFIGILIEHFAGALPLWLAPVH
AVVLNISEGQSEYAADVAKRLKQAGFRVEADLRNEKITYKIREHSVQKLPYQIVVGEKEK
AAGLVAVRARGGQDLGQMTLDTLIERWQREISARSSSI
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgccgaacatcacgcttcctgacggttccgtacgcagcttcgatcatccggtgaccgtg
ctcgaagttgctgcgtcgatcggtgccggtctcgccaaggccgcactggccggcaaggtc
gatggccggctcgtcgatgcctcccactcgatcgagggcgatgcctcgctcgcgatcatc
accgacaagagcgaggaaggcgtcgatatcattcggcattcgaccgcccacctgctcgca
catgccgtcaaggagctctttccggatgcgcaggttacgatcggtccggtgatcgagaac
ggcttttactacgacttctcctacaagcgccccttcacgccggaagatctcgagaagatc
gaaaagcgcatggcggagctcgccaagcgtgagatccctgtcgcgcgtgaagtctggccg
cgcgacaaggcggtcgagttcttcaagtcgcagggcgagaactacaaggccgagatcatt
gcgtcgatcccgcaggccgaggacgtgtccttgtaccgtcagggcgacttcatcgacctg
tgccgcggtccgcacgtcccgtcgaccggcaagctcaaggtcttcaagctgaccaagctc
gctggcgcctactggcgcggcgactccaagaacgagatgctgcagcgcgtctatggcacc
gcctgggcgaagaaggaagacctcgacggctatctgcacatgctcgaagaggccgagaag
cgcgatcaccgcaagcttggccgcttgcttgacctcttccatctgcaggaggaggcgccc
ggcatggtgttctggcatgccaaggggtggacgctgtggcagcaggtcgagcagtacatg
cgccgcacgatcctcgaaaacggctatcaggaagtgaagaccccgcagattgtcgatcgc
tcgctgtgggagcgttccgggcactggggcatgtactcggacctgatgttcacgacccag
tcggaaaagcacgactacgccgtcaagccgatgaactgcccgtgtcacatccagatcttc
aaccaaggcctcaagagctaccgcgatctgccgctgcgcatggccgagttcggctcctgt
caccgcaacgagccctctggctcgctgcacggcatcatgcgcgtccgcaacttcgtgcag
gacgacgcccacattttctgcgccgaagatcaggtgcaagccgagtcggcggccttcatc
gaactcttgcaaaaggtttatgcagacttcggcttcacggaaatcctgatcaagctgtca
actcgtcccgacaagcgcgtcggtaccgacgagcagtgggatgccgccgaggcggcgctg
gcttccgcgctcgacgcccaggggctcgcctatgagttgcagccgggtgagggggcgttc
tatggcccgaagatcgagttctcgttgaaggattgcctgaatcgcgtgtggcagtgcggc
acgctgcagctcgacttcaacctgccggtgcgcctcggcgccgaatacgtcgccgaagac
aacgccaagaaattcccggtgatgctccatcgcgcgatcctcggttcgctcgagcgcttc
attggcatcctgatcgagcacttcgccggcgccttgcccctgtggctcgcccccgtgcat
gcggtcgtgctgaatatctcggaagggcagtcggaatatgccgcggatgtcgccaagcgc
ttgaagcaggcggggttccgcgttgaggcggatttgcgtaacgagaagattacctataaa
atccgcgagcatagcgtgcaaaagctgccctaccagatcgtcgtcggcgaaaaggaaaag
gcggcaggcctggtggccgtgcgcgcccggggcggccaagatcttggtcagatgaccctg
gatacactgatcgagcgttggcagcgcgaaatttcggcgcggtcgagctcgatctga

DBGET integrated database retrieval system