KEGG   Azoarcus sp. KH32C: AZKH_3702Help
Entry
AZKH_3702         CDS       T02502                                 

Gene name
apaG
Definition
(GenBank) unknown function protein
  KO
K06195  ApaG protein
Organism
aza  Azoarcus sp. KH32C
Brite
KEGG Orthology (KO) [BR:aza00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AZKH_3702 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BAL25986
UniProt: H0Q4E7
Position
4109287..4109670
Genome map
AA seq 127 aa AA seqDB search
MTNAEKYRIQVEANAEFVPAQSAPDDGRYVFAYHIKITNTGTATAQLLTRHWVITDSNGK
VQEVRGQGVIGEQPVLAPGENFSYSSGSVLETPVGTMRGSYQMVGEDGHRFDADIPTFVL
AMPRVLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgccgaaaaataccgtatccaggtcgaagccaacgccgaattcgtccccgcc
caatcggcaccggacgacggacgctatgtcttcgcttatcacatcaagatcaccaacacc
ggcaccgcgaccgcccaactgctgacgcgtcactgggtcatcacggacagcaacggcaag
gtgcaggaagtccgcggccagggcgtcatcggcgaacagccggtgctcgcgcccggcgag
aacttctcctactccagcggttcggtactcgaaaccccggtcggcacgatgcggggtagc
taccagatggtcggcgaggacggccaccgcttcgacgccgacattccgaccttcgtgctc
gcgatgccgcgcgtgctgcactga

DBGET integrated database retrieval system