KEGG   Azoarcus sp. KH32C: AZKH_p0480Help
Entry
AZKH_p0480        CDS       T02502                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aza  Azoarcus sp. KH32C
Pathway
aza00071  Fatty acid degradation
aza00072  Synthesis and degradation of ketone bodies
aza00280  Valine, leucine and isoleucine degradation
aza00310  Lysine degradation
aza00362  Benzoate degradation
aza00380  Tryptophan metabolism
aza00620  Pyruvate metabolism
aza00630  Glyoxylate and dicarboxylate metabolism
aza00640  Propanoate metabolism
aza00650  Butanoate metabolism
aza00900  Terpenoid backbone biosynthesis
aza01100  Metabolic pathways
aza01110  Biosynthesis of secondary metabolites
aza01120  Microbial metabolism in diverse environments
aza01130  Biosynthesis of antibiotics
aza01200  Carbon metabolism
aza01212  Fatty acid metabolism
aza02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aza00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZKH_p0480 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    AZKH_p0480 (atoB)
   00640 Propanoate metabolism
    AZKH_p0480 (atoB)
   00650 Butanoate metabolism
    AZKH_p0480 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    AZKH_p0480 (atoB)
   00072 Synthesis and degradation of ketone bodies
    AZKH_p0480 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZKH_p0480 (atoB)
   00310 Lysine degradation
    AZKH_p0480 (atoB)
   00380 Tryptophan metabolism
    AZKH_p0480 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZKH_p0480 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZKH_p0480 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZKH_p0480 (atoB)
Enzymes [BR:aza01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZKH_p0480 (atoB)
Exosome [BR:aza04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZKH_p0480 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C
Motif
Other DBs
NCBI-ProteinID: BAL27363
UniProt: H0Q5V0
Position
pAZKH:complement(524950..526158)
Genome map
AA seq 402 aa AA seqDB search
MLDAYIYAGLRTPIGRHAGALAAVRPDDLAATVIAELIALSPFAASDVEDVVLGCAAQAG
EDARNVARHAALLAGLPPTVAGQTVNRLCGSGLAAVLDCARAVTVGEGALYVAGGVESMS
RAPFVVGKAESAYSREFKVFDTTIGARFPNPRLVEQYGNHSMPETADNVAAEFGITRDES
DRFAAASQAKYAAAKERGFFAGEILPIAVPTGRKSPSLIVADDEHPRPQTTRESLAALKA
LAPEGVVTAGNASGINDGAAAMLVGNRRIGEKAGRKPMARILAGAVAGVEPRIMGVGPAH
AIPKALARAGLTLADMDVIEINEAFAAQVLGCLKLLGLPFDDARVNPNGGAIALGHPLGA
SGARILLTAARELERRQGRYAVVSLCIGVGHGIAVVIERVPA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcctacatctacgccggtctgcgcacgccgatcggacgccacgccggcgca
ctcgccgcggtgcgcccggacgacctcgccgccacggtgattgccgaactcatcgcgctg
tcgccctttgccgcctccgacgtcgaggatgtcgtcctcggctgcgccgcgcaggccggc
gaggacgcccgcaacgtcgcgcgccacgccgcgctgctcgcgggcctgccgccgacggtc
gcgggtcagaccgtcaatcgcctgtgcggcagcgggctcgccgcggtcctcgactgcgcc
cgtgcggttaccgtgggcgaaggcgcgctctatgtcgccggcggcgtcgagagcatgagc
cgcgcgcccttcgtcgtcggcaaggccgaatcggcctacagccgcgagttcaaggtgttc
gacacgacgatcggggcgcgcttcccgaatccgcgtctcgtcgagcagtatggcaaccac
agcatgcccgagaccgccgacaacgtcgccgccgagtttggcatcacgcgcgacgagtcc
gaccgcttcgccgccgcctcgcaggcgaaatacgccgcggcaaaggagcgtggattcttt
gccggagagatcctgcccatcgccgtgccgaccggtcgcaagagcccgtcgctgatcgtc
gccgacgacgagcatccgcgcccgcagaccacccgcgagtcgctcgcggccttgaaggcg
ctggccccggaaggcgtggtgacggccggcaacgcctcaggcatcaacgacggcgccgcg
gcgatgctggtcggcaaccgccgcatcggcgaaaaagcaggcaggaagcccatggcgcgc
attctcgccggagcggtggcgggggtcgaaccgcgcatcatgggggtcggtccggcgcac
gcgatcccgaaggcgctcgcgcgcgcagggctcacgcttgccgacatggacgtcatcgag
atcaatgaagcattcgcggcccaggtcctcggatgcctgaagctactcggcctcccgttc
gacgatgcccgtgtcaatccgaacggcggcgcgatcgcgcttggccatcccctcggcgcc
tcgggcgcccgtatcctgctgacggccgcacgcgagctcgaacgccgccagggacgctac
gctgtcgtcagcctctgcatcggcgttggccacggcatcgccgtcgtcatcgagcgcgtt
cccgcataa

DBGET integrated database retrieval system