KEGG   Azorhizobium caulinodans: AZC_0229Help
Entry
AZC_0229          CDS       T00609                                 

Definition
(GenBank) homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00270  Cysteine and methionine metabolism
azc00920  Sulfur metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AZC_0229
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AZC_0229
Enzymes [BR:azc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     AZC_0229
    2.3.1.46  homoserine O-succinyltransferase
     AZC_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4 Esterase
Motif
Other DBs
NCBI-ProteinID: BAF86227
RhizoBase: AZC_0229
UniProt: A8IJ06
Position
complement(271180..272391)
Genome map
AA seq 403 aa AA seqDB search
MGETVKIETGRQTAEDVKARREADEPHSPLVRFGADKPLRLDAGVELRGLQVAYQTYGEP
NADRSNAILVCHALTGDQHVANVNPVTGKPGWWETMVGPGKPIDTERFFVICANVLGGCM
GTTGPSSTNPATGRAYGLEMPVVTIRDMVNAQAMLLDHLGIERLFCVAGGSMGGMQVLQW
AASYPERVFCALPIATAARHSAQNIAFGEVGRQAVMADPDWRGGDYLNQGVAPHRGLSVA
RMAAHITYMSDQALHRKFGRRLQNRVLPTFGFDADFQVESYLRHQGESFVQRFDANSYLY
VTRAMDYFDLAADYDGVLANAFRSSKTRFCVVSFTSDWLFTTQDSRAIVHALNASGASVS
YAEIESDKGHDAFLLEEPELFDISRGFLDSAARAAGLPPARTR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaacggtcaaaatcgagacgggacgccagacggcggaagatgtgaaggcacgc
cgggaagcggatgagccccattcgccgctcgtgcgcttcggagccgacaagccgctgcgg
ctggacgcgggcgttgaactgcgcgggctccaggtcgcctaccagacctatggcgagccg
aacgcagaccgctccaacgccattctcgtctgccacgcccttaccggcgaccagcacgtg
gccaacgtcaatccggtgacgggcaagcccggctggtgggagaccatggtcggccccggc
aagcccatcgataccgagcgcttcttcgtgatctgcgccaacgtgctcggcggctgcatg
ggcaccaccgggccctcctccaccaatccggccaccgggcgcgcctacgggctggagatg
cccgtggtgaccatccgcgacatggtgaatgcgcaagccatgctgctcgatcatctgggc
atcgagcgcctgttctgcgtcgccggcggttccatgggcggcatgcaggtgctgcaatgg
gcggcgagctatcccgagcgggtgttctgtgccctgcccatcgccaccgccgcgcgtcat
tcggcgcagaacatcgcctttggcgaggtcggccggcaggcggtgatggctgatcccgac
tggcgtggcggcgactatctcaaccaaggcgtcgccccccatcgcgggctctcggtggcg
cgcatggccgcgcacatcacctacatgtccgaccaggcgctgcaccggaaattcgggcgg
cggctgcagaaccgcgtcctgcccactttcggcttcgatgccgacttccaggtggaaagc
tatctgcgccatcagggcgagagcttcgtgcagcgcttcgacgccaattcctatctctac
gtcacccgcgccatggattatttcgacctcgcggcggattatgacggcgtgctcgccaac
gccttccgcagttccaagacgcgcttctgcgtcgtctcattcacttcggactggctgttc
acgacgcaggattcccgcgccatcgtccatgccctcaacgcctccggcgccagcgtctcc
tatgcggagatcgagagcgacaagggccatgacgccttcctgctggaggagccggagctg
ttcgacatctcgcgtggcttcctcgacagcgccgcccgcgcggcgggcctgcccccggcg
aggacgcgttag

DBGET integrated database retrieval system