KEGG   Azorhizobium caulinodans: AZC_0320Help
Entry
AZC_0320          CDS       T00609                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00010  Glycolysis / Gluconeogenesis
azc00071  Fatty acid degradation
azc00350  Tyrosine metabolism
azc00625  Chloroalkane and chloroalkene degradation
azc00626  Naphthalene degradation
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_0320
  Lipid metabolism
   00071 Fatty acid degradation
    AZC_0320
  Amino acid metabolism
   00350 Tyrosine metabolism
    AZC_0320
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AZC_0320
   00626 Naphthalene degradation
    AZC_0320
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AZC_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 adh_short ELFV_dehydrog Ribul_P_3_epim 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: BAF86318
RhizoBase: AZC_0320
UniProt: A8IJK5
Position
complement(367658..368683)
Genome map
AA seq 341 aa AA seqDB search
MTNMMKAAVVHQLGQPLVIEQVPVPEPGPEQILVRIAATGVCHTDLHAVKGDWPVKPKPP
FIPGHEGVGTVVGVGSRVKRVKEGDRVGIPWLHTACGYCPHCRTGWETLCADQQNTGYSV
NGSFAEYAVADPNYVGRLPDKLDWGPAAPVLCAGVTVYKGLKETEVKPGEWVAISGIGGL
GHMAVQYAKAMGMHVVAIDVHPDKLELAKKLGAELVVNAREEDPGAVVQKAIGGVHGVLV
TAVSPKAFEQAFNVLRAHGTMALCGLPPGMFAMPIFDTVLKRITVRGSIVGTRQDLEEAL
EFAGNGQVAAHFSWDKLENINEIFHRMEEGGIDGRIVLNMN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacatgatgaaagccgccgtcgtccaccagctgggccagcccctcgtgatcgag
caggtgcccgtgccagagccaggccccgagcagattctcgtgcgcatcgccgccaccggc
gtgtgccacaccgatctgcatgcggtgaagggcgactggccggtgaagccgaagccgccg
ttcattcccggccatgagggcgtcggcaccgtggtcggcgtcggcagccgggtgaagcgc
gtgaaggaaggcgaccgcgtgggcattccgtggctgcacaccgcctgcggctattgtccc
cactgccgcacggggtgggaaacgctttgcgccgaccagcagaacaccggctattccgtc
aacggcagctttgccgaatatgcggtggctgaccccaattacgtgggccgcctgcccgac
aagctggactggggtccggccgcgcccgtgctgtgcgccggcgtgacggtttacaagggc
ctgaaggaaaccgaggtgaagccgggcgaatgggtcgccatttcgggcatcggcgggctc
ggccacatggccgtgcagtatgccaaggccatgggcatgcatgtggtggccatcgacgtg
caccccgacaagctggaactggcgaagaagctgggtgccgaactggtcgtgaacgcccgt
gaggaagatccgggtgccgtggtgcagaaggccatcggcggcgtccacggtgtgctcgtc
acggccgtctcgcccaaggcgttcgaacaggcgttcaacgtgctgcgcgcccacggcacc
atggccctgtgcggcctgcctccgggcatgttcgccatgcccatcttcgacacggtgctg
aagcgcatcaccgtgcgcggctccatcgtgggcacccgccaggatctggaggaggccctc
gagttcgccggcaacggtcaggtggccgcccacttctcgtgggacaagctcgagaacatc
aacgagatcttccaccgcatggaagaaggcggcatcgacgggcgcatcgtcctcaacatg
aactga

DBGET integrated database retrieval system