KEGG   Azorhizobium caulinodans: AZC_0549Help
Entry
AZC_0549          CDS       T00609                                 

Definition
(GenBank) putative fatty-acid-CoA ligase protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00010  Glycolysis / Gluconeogenesis
azc00620  Pyruvate metabolism
azc00640  Propanoate metabolism
azc00680  Methane metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AZC_0549
   00620 Pyruvate metabolism
    AZC_0549
   00640 Propanoate metabolism
    AZC_0549
  Energy metabolism
   00680 Methane metabolism
    AZC_0549
Enzymes [BR:azc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AZC_0549
Lipid biosynthesis proteins [BR:azc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AZC_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: BAF86547
RhizoBase: AZC_0549
UniProt: A8IMG7
Position
complement(606988..608592)
Genome map
AA seq 534 aa AA seqDB search
MLANLGDFDRLRAAFQWRIPARYNMATHACDGWAARDPSRPALYVPQGADFVPVSYGHLA
EASNRFANALAAKGITRGDRVAILLPQSIEVLVTHLAVYKLGAIAVPLASAFGVEALTFR
LNDSGARALVADAAGLAKLAERPEWLDLIVSRDGPAPGIEGFDDLVSRASATAPGIITGP
DDPALMIYTSGTTGAPKGALHGHRVLIGHVTGQHFTHDSMPAPGDRMWTPSDWAWAGGLL
NTVLSALAHGVPVVVQPPGRFDPESAFRLMKTAGVRNVFIPPTALKMMRAVEKPKERFGF
NLRTVGTAGEALGAETFEWGRAALGVAVNEFYGQTECNYVIGSNARLGVARAGATGKAIP
GHDVRIIRTDGSLCDIGEMGQIAIRAPDPVMFLRYWNQPEATARKYLGDLFVTGDLARLD
ADGYIHFQGRDDDVITSSGYRIGPSEIEDCLLRHPAVQIAAVVGKPDPVRTEIVKAVLVL
RPGYKPGPELVKEIQDFVRTRLAAYEYPREIVFMDELPLTTTGKVIRRLLRDQT
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgaacctcggcgatttcgaccggctgcgcgctgccttccagtggcgcatcccc
gcccgctacaacatggccacccacgcctgcgacggctgggcggcgcgcgatccctctcgc
cccgcgctctatgtgccgcagggcgcggacttcgtgccggtgagctacggccacctcgcg
gaagcctccaaccgcttcgcaaatgcgcttgccgccaagggcatcacgcgcggcgaccgg
gtggcgatcctgctgccgcagagcatcgaggtgctggtcacccaccttgcggtctacaag
ctcggcgccatcgccgtgccgctggcctctgccttcggcgtcgaggccctcaccttccgc
ctgaacgattccggcgcgcgggctctggtggccgacgccgctggtctcgccaagctcgcc
gaacggccggagtggctcgacctcatcgtctcccgtgacggccccgcccccggcatcgag
ggcttcgacgatctcgtgtcgcgcgccagcgccaccgctcccggcatcatcacggggccc
gacgatccggcgctgatgatctacacctccggcaccaccggcgcgcccaagggcgccctg
cacggccaccgggtgctgatcggccatgtgacgggacagcacttcacccacgattccatg
cccgcccccggcgaccgcatgtggacgccctccgactgggcctgggccggcggcctgctc
aataccgtcctgtcggcgctcgcccatggcgtgcccgtggtggtgcagccgcccggccgg
ttcgacccggaatcggcctttcgcctcatgaagacggcgggcgtgcgcaatgtcttcatc
ccaccaaccgcgctcaagatgatgcgcgccgtggagaagccgaaggaacgcttcggcttc
aacctgcgcaccgtgggcacggcgggcgaggcgctgggtgcggagaccttcgaatggggc
cgcgcagcgctgggggtcgccgtgaacgaattctacggccagaccgaatgcaattatgtc
atcggctccaacgcccgcctcggtgtcgcccgcgcgggcgccacgggcaaggcgattccc
ggccatgacgtgcgcatcatccgcaccgacggcagcctctgcgacatcggcgagatgggg
cagatcgccatccgcgcgccggacccggtgatgttcctgcgctactggaaccagccggag
gcgaccgcccgcaagtatctgggcgacctgttcgtgaccggcgacctcgcacggctcgat
gcggacggctacatccatttccaggggcgggacgacgacgtcatcacctcatcgggctat
cgcatcggcccgagcgagatcgaggactgcctgctgcgccatcccgccgtacagatcgct
gctgtggtcggcaagccggacccggtgcgcacggagatcgtgaaggccgtgctggtgctg
cggccgggctacaagccggggccggagctggtgaaggagatccaggacttcgtgcgcacg
cgccttgcggcctacgaatatccgcgcgagatcgtcttcatggacgaactgccgctcacc
accaccggcaaggtcatccgccgcctgttacgcgaccagacctga

DBGET integrated database retrieval system