KEGG   Azorhizobium caulinodans: AZC_1018Help
Entry
AZC_1018          CDS       T00609                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00260  Glycine, serine and threonine metabolism
azc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01130  Biosynthesis of antibiotics
azc01230  Biosynthesis of amino acids
Module
azc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZC_1018
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZC_1018
Enzymes [BR:azc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AZC_1018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAF87016
RhizoBase: AZC_1018
UniProt: A8HQ47
Position
1142999..1144210
Genome map
AA seq 403 aa AA seqDB search
MNALNSYRTGPDENGHFGIHGGRFVAETLMPNILELQAAYEAAKADPAYQSEMAGYLAHY
VGRPSPLYYAERLSEHLGGAKIYLKREELNHTGSHKVNNVLGQILLALRMGKKRIIAETG
AGQHGVATATLCARFGLKCIVYMGAVDVERQKPNVFRMNMLGAEVVPVQSGSRTLKDAMN
EALRDWVTNVHDTFYCIGTVAGPHPYPSMVRDFQSIIGRETREQLMEAEGRGPDSLIAAV
GGGSNAIGLFHEFLDDSGVEIYGVEAAGHGISSGMHAASITGGKPGVLHGNRTYLLMDDD
GQIIEAHSISAGLDYPGIGPEHSWLHDTGRVTYIPCTDKEALEGFQLLSRLEGIIPALEC
AHAIGKVMEIAPTKPKDHLMVVNLSGRGDKDIFTVAEHLGGQI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgcgctcaattcctatcgcaccggccccgacgagaacggccatttcggcatccat
ggcggacgtttcgtcgccgagaccctgatgccgaacattctcgaactgcaggcggcctat
gaggcggccaaggccgacccggcctatcagtccgagatggccggctaccttgcccattat
gtggggcgaccctcgccgctctattatgccgagcgcctgtccgagcatctcggcggcgcg
aagatctatctgaagcgcgaggagctgaaccacaccggctctcacaaggtgaacaacgtg
ctcggccagatcctgctggccctgcgcatgggcaagaagcgcatcattgccgagaccggc
gccggccagcacggcgtcgccaccgcgacgctctgcgcccgcttcggcctgaagtgcatc
gtgtacatgggcgcggtggacgtggagcggcagaagccgaacgtcttccgcatgaacatg
ctgggcgccgaggtggtgcccgtgcagtccggctcgcgcaccctgaaggacgccatgaac
gaggcgctgcgcgactgggtgaccaatgtgcacgacaccttctattgcatcggtacggtg
gcgggcccgcatccctatccgtccatggtgcgcgacttccagtccatcatcggccgcgag
acccgcgagcagctgatggaagccgaaggccgcggcccggacagcctgatcgcggcggtg
ggcggcggctcgaacgccatcggcctgttccacgaattcctcgacgacagcggtgtcgag
atctacggcgtcgaggcggccggccacggcatctcctcgggcatgcacgccgcctccatc
accggcggcaagccgggcgtgctgcacggcaaccgcacctatctcctgatggatgacgac
ggccagatcattgaggcccattccatctccgccggcctcgactatccgggcatcgggccg
gagcattcctggctgcacgatacggggcgggtgacctacattccctgcaccgacaaggag
gctctcgagggcttccagcttctctcccgtctcgaaggcatcatcccggcgctggaatgc
gcccatgccatcgggaaggtgatggagatcgcaccgaccaagccgaaggaccatctgatg
gtggtcaatctgtccggccgcggcgataaggacatcttcactgtggccgaacatctgggg
ggccagatatga

DBGET integrated database retrieval system