KEGG   Azorhizobium caulinodans: AZC_1365Help
Entry
AZC_1365          CDS       T00609                                 

Definition
(GenBank) asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00250  Alanine, aspartate and glutamate metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZC_1365
Enzymes [BR:azc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AZC_1365
Peptidases [BR:azc01002]
 Cysteine Peptidases
  Family C44
   AZC_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: BAF87363
RhizoBase: AZC_1365
UniProt: A8I1E3
Position
1542251..1544020
Genome map
AA seq 589 aa AA seqDB search
MCGICGEVNRNGSVRMAPLEAMSDALSPRGPDGFGLLAQGDVALAHRRLSILDLKATSQQ
PMVDSQLGLAIAFNGCIYNFRDLRQDLKAKGYTFFSEGDTEVILKAYHAWGADCVLRLKG
MFAFAIWEMWTGRVVLARDRLGIKPLYLADVGSSLRFASTLPALLAGGGVDTAIDPVGLH
HYMSFHSVVPAPRTILRGVRKLPPATLLTLEPDCQRSERQYWSVRMGGDTDTDDMGEEEW
RETLIHCLLRAVERRTVSDVPVGVLLSGGLDSSLLVALLAQLGHEDIRTFSVGFEAVGGL
KGDEFEYSDLMARAYGTDHTKIVISPERVLSALPGVIGAMSEPMMSHDCVGFYLLAEEVS
RHVKVVQSGQGADETFAGYHWHEKMLTAADPLDDYARLYFDRDHAEMAHALSPDMISGDH
SRIFVKDFFDRCGETSPINKTLQIDTEIMLVDDPVKRVDNMTMAFGLETRVPFLDHEMVE
LATRIPSELKVKSGGKHILKEAARRILPPEVVDRPKGYFPVPALKYIRGPYLDFARDVLN
QQAARDRGIFRQDYVEGLLGDPEGSLTPKGHSKLWQVTVLEHWLQTHGV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatctgcggtgaggtgaacaggaacggctcggtccggatggcgccgcttgag
gctatgtcggatgcgctgtcaccgcggggaccggacggtttcggcctgcttgcccagggc
gacgtggcgctggcccatcgcaggctcagcattctcgatctcaaggccacctcccagcag
ccgatggtggacagccaactggggctcgccatcgctttcaacggctgcatctacaatttt
cgcgacctccgtcaggacctgaaagccaagggctacaccttcttctccgaaggcgacacc
gaggtgatcctcaaggcctatcatgcttggggcgccgattgcgttctgcggctgaagggc
atgttcgcctttgccatttgggagatgtggacagggcgtgtcgtgctggcgcgggacagg
ctgggcatcaagccgctctatctcgcggacgtgggctcttccttgcgctttgcctccacc
ttgccggccctgctggcgggcggcggggtggatacggccatcgatcctgtcggccttcac
cattacatgagctttcacagcgtagtgccggcaccccggaccatcctgcgaggcgtgcgc
aagctgcccccggcgacgctgctgacgctggaacccgactgccaacgcagcgagcggcaa
tactggtccgtccgcatgggaggcgataccgacacggacgatatgggcgaggaggagtgg
cgcgagacgctcatccactgccttctgcgggccgtggagcggcggacggtctcagacgta
ccggtgggcgtcttgctctccggcgggctcgacagctctcttctcgtggccctgctggcc
caactggggcatgaggacatccgcaccttttccgtcggcttcgaagccgtgggcgggctg
aagggcgacgagttcgaatattccgatctcatggcccgcgcttacggcacagaccacacc
aagatcgtgatctcgccggagcgcgtgctctcggcgctgccgggcgtcatcggcgccatg
tccgagcccatgatgagccacgattgcgtgggcttctatctgctggcggaggaagtgtcc
cggcatgtgaaggtggtgcagagcgggcagggggcggacgagaccttcgccggttatcac
tggcatgagaagatgctcaccgccgccgatccgctggatgattacgcacggctctatttc
gaccgggatcatgcggagatggctcacgccctctctccggacatgatctcgggggaccac
agccggatatttgtaaaggacttcttcgatcgctgcggcgagacctcgcccatcaacaag
accctgcagatcgacacggagatcatgctggtcgacgatcccgtaaaacgcgtggacaac
atgaccatggccttcggcctcgagacccgcgtccccttcctcgaccatgaaatggtggaa
ctggccacgcgcatcccctcggaactgaaggtgaaatcgggcggcaagcacatattgaag
gaggctgcgcgccgtatcctgccccctgaagtggtggaccggccgaagggctatttcccg
gtgccggcgctcaaatacatccgcggcccctatctcgatttcgcgcgggacgtgctgaac
cagcaggccgcgcgcgatcgcggcatcttccggcaggactatgtggagggcctgctcgga
gaccccgaagggagcctcacgccaaaggggcattccaagctctggcaggtcaccgtgctg
gaacactggctccagacgcacggggtctga

DBGET integrated database retrieval system