KEGG   Azorhizobium caulinodans: AZC_1699Help
Entry
AZC_1699          CDS       T00609                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00900  Terpenoid backbone biosynthesis
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZC_1699
Enzymes [BR:azc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     AZC_1699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAF87697
RhizoBase: AZC_1699
UniProt: A8I477
Position
1945154..1946323
Genome map
AA seq 389 aa AA seqDB search
MTSVSILGATGSVGRSTVRVLEGERERFRVEAVAGGRDAAGLAELAIHLGAKFAAVADDA
AGAELKARLAGTGIACGAGRTAVLEAAARDADIVVAGISGIAGLEPTVAAFRAGRRIGVA
NKECLVAAGAFFTAEAERVGAEIFPVDSEHNAIFQALSAGPRAAVEKVQITASGGPFRTA
PREAIAKAGPAAALKHPNWSMGAKITIDSATLMNKGLELIEAHHLFGVPPEQLEVIVHPE
SIVHGLVAFEDGSVVAVLAMPDMALPIAHCLSHPGRLPTTCRKLDLAALGRLTFEAPDLD
RFPCLSLALSALGEGGAAPTILNGANEVAVAAFLEGRIGFYGISAIVEETLALATRGAAP
ASVAEALQLDAEARRIALSLLPKFAAKAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacttcggtttccatcctcggcgccacgggttcggtcggccgcagcaccgtcagggtg
ctggagggggaacgggagcggttccgggtggaggcggtggcgggtggtcgtgatgcggcc
gggctcgccgagcttgccatccacctcggggccaagttcgccgccgtggccgatgatgcg
gccggtgccgagctgaaggcccggctcgccggcacggggatcgcctgcggcgccggccgg
acggcggtgcttgaggcggcggcgcgggatgcggatatcgtggtggcgggcatttccggc
attgcgggccttgagccgaccgtcgcggcgttccgcgccggccggcggatcggcgtcgcc
aacaaggaatgcctcgtggccgccggtgccttcttcacggccgaggcggagcgggtcggg
gcggagatcttccccgtcgattccgagcacaatgccatcttccaggccctgtccgcgggg
ccgcgcgcggccgtggagaaggtgcagatcaccgcgtcgggcggaccgttccgcaccgcc
ccgcgcgaggcgatcgccaaggccgggccggcggcggcgctgaagcaccccaactggtcc
atgggggccaagatcaccatcgattcggccacgctcatgaacaaggggctggaactgatc
gaggcgcaccacctcttcggcgtgccgccggagcagctcgaggtgatcgtccatcccgaa
tccatcgtccacggtctggtggcgttcgaggacgggtcggtggtggcggtgctcgccatg
cccgacatggccctgcccatcgcccattgcctcagccatcccggccgtctgcccaccacg
tgccggaagctcgaccttgccgctctcggccgcctcaccttcgaggcgccggatctcgac
cgcttcccgtgcctgagcctcgcgctgtccgcgctgggggaggggggggcggcaccgacg
atcctcaacggcgccaatgaggtggcggtcgccgccttcctcgaaggccgcatcggcttc
tacggaatcagtgccatcgtcgaggaaacgctggcgctggcgacgcgcggtgcggcaccc
gcatcggttgccgaggcgctgcaactcgacgccgaggcgcggcgcattgccctttccctc
ttgcctaagtttgccgcaaaggcatcctaa

DBGET integrated database retrieval system