KEGG   Azorhizobium caulinodans: AZC_2589
Entry
AZC_2589          CDS       T00609                                 

Definition
(GenBank) protein of unknown function
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
azc  Azorhizobium caulinodans
Pathway
azc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZC_2589
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azc02044]
    AZC_2589
Secretion system [BR:azc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZC_2589
SSDB
Motif
Pfam: T6SS_HCP UPF0164
Other DBs
NCBI-ProteinID: BAF88587
RhizoBase: AZC_2589
UniProt: A8IB02
Position
2917166..2917645
AA seq 159 aa
MVAIYVKYDGIDGEATHQDHKKWIDVLSLSWGVGRGISTVSGSGNNREASEPSISEVSIV
KMFDASSPKLFTEACTGNTGKTVKIDLTTTGSPGATYCTYTLTNALISSYSVSSGGDRPT
ESISISFTKLEFKFTPYDDKNKAGTPVTVSYDLATTKSA
NT seq 480 nt   +upstreamnt  +downstreamnt
gtggtggccatatacgttaaatatgacggcatcgacggcgaagccacgcatcaggaccac
aagaagtggatcgacgtcctttcgctctcctggggcgtcgggcgcggaatctccaccgtc
tcgggttcgggcaacaaccgcgaggcctcggagccctccatcagcgaagtgtccatcgtc
aagatgttcgatgcgtcctcgcccaagctcttcacggaggcctgcacgggcaacaccggc
aagaccgtgaagatcgacctcaccaccaccggcagccccggcgcgacctactgcacctac
acgctgaccaacgcgctgatctcgtcctactcggtgtcctcgggcggcgaccgccccacc
gagtccatctcgatcagcttcaccaagctcgagttcaagttcaccccctacgacgacaag
aacaaggccggcaccccggtcaccgtgtcctacgacctcgccaccaccaagagcgcgtaa

DBGET integrated database retrieval system