KEGG   Azorhizobium caulinodans: AZC_2596
Entry
AZC_2596          CDS       T00609                                 

Gene name
ompA
Definition
(GenBank) OmpA family protein
  KO
K11892  type VI secretion system protein ImpK
Organism
azc  Azorhizobium caulinodans
Pathway
azc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    AZC_2596 (ompA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:azc02044]
    AZC_2596 (ompA)
Secretion system [BR:azc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   AZC_2596 (ompA)
SSDB
Motif
Pfam: DotU OmpA
Other DBs
NCBI-ProteinID: BAF88594
RhizoBase: AZC_2596
UniProt: A8IB18
Position
2925898..2927382
AA seq 494 aa
MARDTDPQSDAETTIVAPAARWRAPANEQPVSQVAPGRAAPVGTFPFPRPPGSDGRLKPV
EREAPRKGPAAPTVPPLPTARTDDRALKAALEVYQDNPGLALAVPIFELLVRAQLQPTGD
ADEFHDHLLDELQTFETQAISRGLSQQHTRLILYAIAATADDCILNTRWGNESDWAAKTL
VSALFQETWGGERFFGLLNQMMAAPHSVVREIEFYYFCLQFGFEGKYRLAANGSGELTRL
KDDVFQFLRSVRGGVKPELSPNWRGLSAENQGPGDLLPLVFYGAGIALFLLLLFIGYSLV
LRREANLAVQQVQNLMAEPVVIRTPPVATAAAAPAPAPTPAAPPAPKPPAETPLQVISGF
LEPEQQAKLITVFGRGNSVVIQTQQELFASASTTLRPPYPEVIAKVAAALAKFKGPVNVL
GYTDNVPIRTATFPDNLALSTARARAVGQALAAGLGGNARITTVGKGDADPVASNDTPDG
RQKNRRVEIVLTPQ
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggccagagacactgatccacaatcggacgcggagacgaccatcgtcgctcccgccgcg
cggtggcgtgctccggccaatgagcaacctgtgtcgcaggtcgctccgggccgtgcggcg
cctgtcggcaccttcccctttccccggccgccaggcagcgacggccgcctgaagcctgtc
gagcgggaggccccgcgcaagggaccggccgcgccgaccgtgccgcccctgccgaccgcg
cgcaccgatgaccgtgccctcaaggcggcgcttgaggtctatcaggacaatccgggcctt
gcgctcgccgttccgatcttcgagttgctggtgcgggcgcagttgcagcccaccggcgac
gcggacgagttccacgaccacctgctcgatgagctccagaccttcgagacccaggccatc
tcgcgcggcctgtcgcaacagcacacgcgcctgatcctctacgcgatcgcggccacggcc
gacgactgcatcctgaacacgcgctggggcaacgagagcgactgggcggcgaagacgctg
gtctcggcgctcttccaggaaacctggggcggcgagcggttcttcggcctgctcaaccag
atgatggcggcgccgcactcggtcgtgcgcgagatcgaattctactatttttgccttcag
ttcggcttcgagggcaaataccgcctcgccgccaacggcagcggggaactgacgcggctc
aaggacgacgtcttccagttcctgcgcagcgtgcgcggcggcgtgaagccggaactctcg
cccaactggcgcggcctttccgccgagaaccagggccccggcgatctgctgccgctggtg
ttctacggcgccggcatcgcgctcttcctgctgctgctgttcatcggctattcgctggtg
ctgcggcgcgaggcgaacctcgccgtccagcaggtgcagaacctcatggccgagccggtg
gtcatccgcacgccgccggtggcgacggcggccgccgccccggcacctgctcccacgccc
gccgctccgcccgcgcccaagccgccggccgagacgccccttcaggtcatctccggcttc
ctggagcccgagcagcaggccaagctcatcaccgtgttcggccgtggcaattcagtggtc
atccaaacccagcaggagctgttcgcctccgccagcacgaccctgcgcccaccctatcct
gaggtgatcgccaaggtcgcggcggcgctcgccaagttcaaggggccggtcaacgtgctg
ggctacaccgacaacgtgcccatccgcaccgccaccttcccggacaatctcgccctctcg
acggcccgcgcccgcgcggtgggacaggccctcgcggcgggcctcggcggcaacgcccgc
atcacgacggtcggcaaaggcgacgccgaccccgtcgcgtccaacgacacgccggacggg
cggcagaagaaccgccgcgtcgaaatcgttctcacgccgcaatag

DBGET integrated database retrieval system