KEGG   Azorhizobium caulinodans: AZC_2875Help
Entry
AZC_2875          CDS       T00609                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00071  Fatty acid degradation
azc00072  Synthesis and degradation of ketone bodies
azc00280  Valine, leucine and isoleucine degradation
azc00310  Lysine degradation
azc00362  Benzoate degradation
azc00380  Tryptophan metabolism
azc00620  Pyruvate metabolism
azc00630  Glyoxylate and dicarboxylate metabolism
azc00640  Propanoate metabolism
azc00650  Butanoate metabolism
azc00900  Terpenoid backbone biosynthesis
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01120  Microbial metabolism in diverse environments
azc01130  Biosynthesis of antibiotics
azc01200  Carbon metabolism
azc01212  Fatty acid metabolism
azc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:azc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AZC_2875
   00630 Glyoxylate and dicarboxylate metabolism
    AZC_2875
   00640 Propanoate metabolism
    AZC_2875
   00650 Butanoate metabolism
    AZC_2875
  Lipid metabolism
   00071 Fatty acid degradation
    AZC_2875
   00072 Synthesis and degradation of ketone bodies
    AZC_2875
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AZC_2875
   00310 Lysine degradation
    AZC_2875
   00380 Tryptophan metabolism
    AZC_2875
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AZC_2875
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AZC_2875
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AZC_2875
Enzymes [BR:azc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AZC_2875
Exosome [BR:azc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AZC_2875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAF88873
RhizoBase: AZC_2875
UniProt: A8ID26
Position
3274845..3276032
Genome map
AA seq 395 aa AA seqDB search
MVDAVIVSTARTPIGKAQRGAFNITKGADMAAHAIRHALAKGKVDPASVEEVVLGCGYPE
GATGGNVARHASLIAGIPVTASGATVSRFCASGLEAIAGAARRIVMDGVPVAVAGGVESI
SLVQPVNRELFRNDWLMANRPDIYVTMIETGDTVARRYGVSREAQDQFALASQQRTARAQ
AGGLFDDEIVPMTVEKEITDKASGETRRESVTLAKDEGNRADTTLEGLAKLKPVRGDDWY
VTAGNASQLSDGASATVLMSSTEAARQNAPVLGIFRGYATAGCEPDEMGIGPVFAVPRLL
ERQGLKVSDIGLWELNEAFASQSLYCRDTLGLDPEIVNVNGGAISVGHPFGMSGARLVGH
AVLEGRRRGVRYAVVTMCIAGGMGAAGLIEINPDA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgccgtcatcgtctccaccgcccgcacgcccatcggcaaggcgcagcgcggc
gcgttcaacatcaccaagggcgcagacatggccgcccacgccatccgccacgcgcttgca
aagggcaaggtggacccggccagcgtggaagaggtggttctcggctgcggttatcccgaa
ggcgccacgggcggaaacgtcgcccgccatgcctcgctgatcgcgggcataccggttacc
gcctccggcgccaccgtgagccgcttctgtgcctccggccttgaggccattgcgggcgcg
gcccggcgcatcgtcatggatggcgtgccggtggcggtcgccggcggcgtggaaagcatc
tcgctggtgcaacccgtcaatcgcgagctgttccgcaacgactggctgatggccaacagg
ccggacatctacgtcaccatgatcgagaccggcgacacggtggcccgccgctacggcgtc
tcgcgcgaggcgcaggaccagttcgcccttgccagccagcagcgcaccgcccgtgcgcag
gctggcggcctgttcgatgacgagatcgtccccatgacggtcgagaaggaaatcaccgac
aaggcgagcggcgagacgcgccgcgagagcgtgaccctcgccaaggatgaaggcaaccgc
gcggacacgacgctggagggcctcgccaagctgaagccggtgcgcggcgacgactggtat
gtcaccgccggcaatgcgagccagctctcggacggcgcctcggccaccgttctcatgtcc
tccaccgaggccgcgcggcagaatgcgcccgtattgggcatcttccgcggctatgccacc
gccggctgcgagccggacgagatgggcatcggcccggtgttcgccgtgccgcgtctgctg
gaacggcagggcctgaaggtctccgacatcggcctgtgggagctgaacgaggcctttgcg
tcccagtccctttactgccgggacacgctcggcctcgaccccgagatcgtgaacgtgaac
ggcggcgccatttccgtcggccatcccttcggcatgagcggcgcccggctcgtcggccat
gcggtgctggaaggccggcgccggggcgtgcgctacgcggtcgtcaccatgtgcatcgcc
ggcggcatgggcgcagccggcctcatcgaaatcaacccggacgcctaa

DBGET integrated database retrieval system