KEGG   Azorhizobium caulinodans: AZC_3118Help
Entry
AZC_3118          CDS       T00609                                 

Definition
(GenBank) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00340  Histidine metabolism
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AZC_3118
Enzymes [BR:azc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     AZC_3118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG
Motif
Other DBs
NCBI-ProteinID: BAF89116
RhizoBase: AZC_3118
UniProt: A8IBU0
Position
3569955..3570935
Genome map
AA seq 326 aa AA seqDB search
MSDTLILAVPSKGRLQENVHAFFARAGMPLVQARGAREYRGALGGVDNVEVAYLSASEIA
AALASGAVHVGVTGEDLVRENIPDADKRVMLLEKLGFGHANVVVAVPQAWIDVRSMEDLD
DVAGHFHARTGRRIRVATKYVNLTRSFFARHGIVDYRIVESAGATEGTPAAGSAELIVDI
TTTGATLAANALKVVDDGVMLRSEANLVASLTAPWGEAQHAAARAMFDRMAAEKRARTMR
EVRTRFIQCDTNLVDEAVSRFRCVAPFGGPTSSGMLTLHCPPDTLHALSLFLRERGASMV
TVGPIEYVFAAENPLYEALQARLAGA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacacgctgatccttgccgttccctccaagggccgccttcaggaaaacgtccac
gccttcttcgcccgcgcggggatgccgctggtgcaggcgcgcggcgcacgcgagtatcgc
ggcgcgctgggcggggtggacaatgtggaggtcgcctatctctcggcctccgagatcgcg
gcggcgctggcttccggggccgtccatgtgggcgtcactggcgaagacctcgtgcgcgag
aacatcccggatgccgacaagcgcgtgatgctgctggagaagctcggcttcggccacgcc
aatgtggtggtggcggtgccgcaggcctggatcgacgtgcggtccatggaagacctcgac
gatgtcgccggtcacttccacgcccgcaccggccggcgcatccgggtggccaccaaatat
gtgaacctcactcgcagcttcttcgcccgtcacggcatcgtggactatcggatcgtggaa
agcgcgggcgcgaccgaaggcacgcccgccgccggcagcgccgaactcatcgtggacatc
accaccaccggcgcgacactggccgcaaacgccctgaaggtggtggacgacggcgtgatg
ctgcgctcggaggccaatctcgtcgcctcgctgaccgccccatggggcgaggcgcagcat
gcggcggcccgcgccatgttcgaccgcatggcggccgaaaagcgcgcccgcaccatgcgc
gaggtgcgcacccgcttcatccagtgcgatacgaacctcgtggacgaggctgtgagccgc
ttccgctgcgtggcgcccttcggcgggccgacctcctcgggcatgctcacgctgcactgc
ccgccggacacgctccacgccctctccctgttcctgcgcgagcggggagcgagcatggtg
acggtgggcccgatcgaatacgtgttcgcggccgaaaacccgctctatgaggcgcttcag
gcccggctcgccggggcctga

DBGET integrated database retrieval system