KEGG   Azorhizobium caulinodans: AZC_3119Help
Entry
AZC_3119          CDS       T00609                                 

Definition
(GenBank) putative acyltransferase
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl_transf_3 DUF1624 DUF418 NCE101
Motif
Other DBs
NCBI-ProteinID: BAF89117
RhizoBase: AZC_3119
UniProt: A8IBU3
Position
complement(3570911..3572110)
Genome map
AA seq 399 aa AA seqDB search
MRRMVRFEALDAWRGICALLVVLFHFCFIFASPLMDARLVANAYLFVDFFFVLSGFVVSH
AYRDRLHDAESWVGFVIRRFGRLWPLHAALLAAFVAFVGLANLLPHPDRLALSWGPGEYS
AVAIPLHLMLLNAVNLHGMAWNAPSWSIGAEFYTYLFFGAVCLLARGRLALVAGVIALAC
VVLLACVSPTYMNSTADFGLFRCMAGFFTGVVAYHVHERLAQAPMRPSVTGTLVEGVTVA
LVVLFVVKAGRGPDAVAAISLGAPAVFAAAVLVFAREAGQVSRLLRGAPFAALGRWSYSI
YMGHQIVLMVAVYGVWLANRRFGFGREIEVMIEGHAKTLYDLGGVVPSFALLAVILGVVI
ALAAFTYSRIEEPARRAFNGYARRREDRIGRAQAPASRA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagaatggtccgatttgaagctctcgatgcgtggcgcgggatctgcgcattgctc
gttgtattgtttcatttctgtttcattttcgcgtctccgctcatggatgcgcggctggtg
gccaatgcctatctgttcgtggacttcttcttcgtcctgagcggtttcgtggtgtcccac
gcctatcgcgacaggctccatgatgcggagagctgggtcggcttcgtcatccgccgcttc
ggccgtctgtggcctctgcatgcggcgctgctggctgccttcgtggctttcgttggcctt
gccaacctgctgccgcatcccgatcgcctcgccctctcctgggggccgggcgaatattcg
gcggtggcgatcccgctccacctcatgctgctcaatgcggtgaacctgcacggcatggcg
tggaacgcgccgagctggagcattggcgcggaattctacacctatctcttcttcggcgcg
gtctgccttctggcgcgggggcgcctcgcgctggtcgccggggtcattgcgctagcctgc
gtcgtgctgctggcctgcgtctcgcccacctacatgaattcgaccgccgatttcggcctc
ttccgctgcatggcgggcttctttaccggcgttgtcgcctatcacgtccatgagcggctc
gcgcaggcgcccatgcggccttcggtgacggggacgctggtggaaggcgtgaccgtcgcc
ctcgtggtcctgttcgtggtgaaggccgggcgcgggccggatgcggtggcagccatcagc
ctgggtgcgcctgccgtgttcgcggcggcggtgctggtcttcgcgcgcgaagcggggcag
gtgtcccggctgctgcggggggcgcccttcgcagcactcggccgctggtcctattccatc
tacatgggccaccagatcgtgctgatggtggccgtttatggcgtctggctggccaatcgc
cggttcggcttcgggcgcgagatcgaggtcatgatcgagggccacgccaagacgctctac
gatcttggcggcgtcgtgccgagctttgcgctgctggccgtcatcctcggtgtcgtgatt
gcgcttgcggccttcacgtacagccgcattgaggagccggcccggcgggcgttcaatggc
tacgcccgccgccgcgaagaccggatcggtcgcgctcaggccccggcgagccgggcctga

DBGET integrated database retrieval system