KEGG   Azorhizobium caulinodans: AZC_3123Help
Entry
AZC_3123          CDS       T00609                                 

Definition
(GenBank) putative DEAD-box protein
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
azc  Azorhizobium caulinodans
Pathway
azc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:azc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AZC_3123
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:azc03019]
    AZC_3123
   03009 Ribosome biogenesis [BR:azc03009]
    AZC_3123
Enzymes [BR:azc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AZC_3123
Messenger RNA biogenesis [BR:azc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     AZC_3123
Ribosome biogenesis [BR:azc03009]
 Prokaryotic Type
  rRNA helicases
   AZC_3123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DbpA ResIII CMS1
Motif
Other DBs
NCBI-ProteinID: BAF89121
RhizoBase: AZC_3123
UniProt: A8IBV3
Position
3579227..3581263
Genome map
AA seq 678 aa AA seqDB search
MLCERVARQSDSNAQEPCAVRHGAAIFLPLETASSLRCNMRAPLRSERSALFGATMVSSI
RRCVGSGSSAGCPFAACVLGRFGDRKGFRPVPFETSSPALARALAARSYTDPTPVQSAVT
APEATGRDMLVSAQTGSGKTVAYGLAVGQTLLGSDERLPAPGAPLALVIAPTRELALQVH
KELAWLYAEAGGRIVACVGGMDPLREKRQLQDGAHVVVGTPGRLRDHLERGRLDMSQLAA
VVLDEADEMLDLGFREDLEFILDSTPGKRQTLLFSATMPRDIAALARQYQHDALRIEVAG
QKVGHADIEYRAVRVSPREIEHAVVNLLRFFEAPGAIVFCNTREAVRHLTATLQERGFSA
VALSGELGQNERNLALQALRDGRARVCVATDVAARGIDLPGLGLVIHAELPHDAESLQHR
SGRTGRAGRKGVSVLLVPPGRRRKADQLLAEARVVPAWSGPPTAEEVRALDQERMLSDPQ
LSELPAAEDANLAEALLAQYSAQELATALVRLYRARLPAPEEVTDPGEGRQKRDGRAGLG
ATGTGGAWFRLAVGRRKNADPKWLLPLICRRGGVTKGDIGAIRIFENETLFEIAEPLADS
FIHSARASAAGDYPIEPHDGSAPERRGPPRGHGPAAGRGAAGGKGKGYGNQAGVRSWGNG
PGGQKASHGARGKVRPHG
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
gtgctttgcgagcgggttgcgcgccaatcggatagcaatgcacaggagccatgcgcagtc
cgccatggcgccgccatcttcttgccgttagaaacagcgtcatcactgcggtgcaatatg
cgcgcgccgcttcgatctgaacggtcggccctgtttggcgcgaccatggtttcttccatt
cgcagatgtgtgggcagcgggtcttccgccgggtgccccttcgctgcatgcgtcctcggc
aggttcggggaccggaaaggttttcgacccgtgcccttcgagacgtcttcccccgccctc
gcccgcgcgctggcggcccgctcctatacggacccgacgccggtccagagcgcagtgacc
gcccccgaggcgaccggccgcgacatgctggtctccgcgcagaccggctccggcaagacc
gtggcctatggcctcgccgtcggccagacgctgctcggcagcgatgagcgcctgccggcg
ccgggcgcgcccctcgccctcgtcatcgcccccacccgcgagctcgcgcttcaggtccac
aaggaactggcctggctctatgcggaagccggcggccgcatcgtcgcctgcgtcggcggc
atggaccctctgcgcgagaagcgccagcttcaggacggcgcccatgtggtggtcggcacc
ccgggccgcttgcgcgaccatctggagcgcggccgactcgacatgagccagctcgccgcc
gtggtgctggacgaagccgacgagatgctcgacctcggcttccgtgaggatctggaattc
atcctcgattccacgcccggcaagcgccagaccctgctgttctcggcgaccatgccgcgc
gacatcgccgccctcgcccgccagtaccagcacgatgccctgcgcatcgaggtggcgggc
cagaaggtcggccatgccgacatcgaatatcgcgccgtgcgcgtctcgccccgcgagatc
gagcatgcggtggtgaacctgctgcgcttcttcgaggcgcccggcgccatcgtcttctgc
aacacccgtgaggcggtgcgccacctgacggccacccttcaggagcgcggcttctccgcc
gtcgccctctccggtgagctcggccagaacgagcgcaaccttgcccttcaggccctgcgc
gacggccgcgcccgcgtctgcgtcgccaccgacgtcgccgcgcgcggcatcgacctgccc
ggcctcggcctcgtgatccatgcggaactgccgcatgacgcagaaagcctccagcaccgc
tccggccgcaccggccgcgcgggccgcaagggcgtgagcgtcctgctcgttccgccgggc
cgccgccgcaaggcggaccagctgctcgccgaggcccgcgtggtgcccgcctggagcgga
ccgcccaccgccgaggaagtgcgcgccctcgatcaggagcgcatgctctccgatccgcag
ctctccgaactgcccgccgccgaggatgccaatctcgccgaggcgctgctggcccagtac
tccgcgcaggaactcgccaccgccctcgtgcgcctctatcgcgcccgcctgccggcgccg
gaggaagtcaccgatcccggcgagggccggcagaagcgcgacggccgcgcgggccttggt
gccaccggcacgggcggcgcctggttccgcctcgcggtcggccggcgcaagaatgccgat
cccaagtggctgctgccgctcatctgccgccgcggcggcgtgacgaagggcgacatcggg
gccatccgcatcttcgagaacgagaccctgttcgagatcgccgagccgctggccgactcg
ttcatccactccgcccgcgccagcgcggcgggcgactatcccatcgagccccatgacggc
agcgcgccggagcggcgcggtccgccgcgcggccacggtcccgcggccggccggggcgcc
gccggcggcaagggcaagggctacggcaaccaggccggcgtgcgcagctggggcaacggc
ccgggcggccagaaggcctcccatggtgctcgcggaaaggtgcgcccgcacggctga

DBGET integrated database retrieval system