KEGG   Azorhizobium caulinodans: AZC_3125Help
Entry
AZC_3125          CDS       T00609                                 

Definition
(GenBank) hypothetical protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2478
Motif
Other DBs
NCBI-ProteinID: BAF89123
RhizoBase: AZC_3125
UniProt: A8IBV8
Position
complement(3581798..3582385)
Genome map
AA seq 195 aa AA seqDB search
MSRRRQEAGMGQAAERDVALAEPDARILALAGADRARIQGLLSAAAEHFTATGWRVMGVI
EEIAADGEDVWLRDLVTGARHKLTQDLGPGAAGCTLDPAGLAAACALVQAAVDAWASEPQ
TQPAVVILSKFGRQEAEGRGLTHAFHAAVAADLPVLTSVSPTVAGQWEAFAGPLARIAPV
EMAAVAGWQERLAPA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcgaaggcgacaggaggccggaatggggcaggcggcggaacgggacgtggcgctc
gcggagccggacgcacgcatccttgcgctcgccggcgcggaccgcgcgcgcatccagggg
ctgctgagcgcggcggcggagcacttcacagccacgggctggcgcgtcatgggggtgatc
gaggagatcgcggccgatggcgaggacgtctggctgcgggatctcgtgaccggcgcccgt
cacaagctgacgcaggatctcggtcccggcgcggccggctgcacgctcgatccggcgggg
ctcgcggcggcctgtgcgctggtccaggcggccgtggacgcctgggcgagtgagccacag
acgcagccggccgtggtcattctgagcaagttcggccgccaggaagcggaggggaggggc
ctgacccacgcttttcacgcggcggtggcggcggacctgcccgtgctcacttcggtttcc
cccaccgtcgccgggcagtgggaggcattcgccggtcccctcgcgcggatcgcgccggtg
gagatggcggcagtggccggctggcaggagcgcctcgcaccggcctga

DBGET integrated database retrieval system