KEGG   Azorhizobium caulinodans: AZC_3132Help
Entry
AZC_3132          CDS       T00609                                 

Definition
(GenBank) aspartate aminotransferase A
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00220  Arginine biosynthesis
azc00250  Alanine, aspartate and glutamate metabolism
azc00270  Cysteine and methionine metabolism
azc00330  Arginine and proline metabolism
azc00350  Tyrosine metabolism
azc00360  Phenylalanine metabolism
azc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
azc00401  Novobiocin biosynthesis
azc01100  Metabolic pathways
azc01110  Biosynthesis of secondary metabolites
azc01130  Biosynthesis of antibiotics
azc01210  2-Oxocarboxylic acid metabolism
azc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AZC_3132
   00270 Cysteine and methionine metabolism
    AZC_3132
   00220 Arginine biosynthesis
    AZC_3132
   00330 Arginine and proline metabolism
    AZC_3132
   00350 Tyrosine metabolism
    AZC_3132
   00360 Phenylalanine metabolism
    AZC_3132
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AZC_3132
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    AZC_3132
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:azc01007]
    AZC_3132
Enzymes [BR:azc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     AZC_3132
Amino acid related enzymes [BR:azc01007]
 Aminotransferase (transaminase)
  Class I
   AZC_3132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP AAA_lid_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: BAF89130
RhizoBase: AZC_3132
UniProt: A8IBX4
Position
3589299..3590501
Genome map
AA seq 400 aa AA seqDB search
MSLLSSALKRIKPSPTIAISNKARELKATGRDIIALSAGEPDFDTPDNIKEAAIAAIRRG
ETKYTAVDGMPELKAAICRKFKRENGLDYKPSQVTVGTGGKQVLFNALVATVDAGDEVLI
PAPFWVSYPDIVEFCGGKPVSVPTTIEDNFKLRPDVLEAHITPKTKWLIFNSPSNPSGAA
YSFDELKALTDVLLRHPHVMILTDDMYEHLVYDDFKFVTPAQVEPQLYDRTLTMNGVSKA
YCMTGWRIGYAAGPEALIKAIGTLQSQSTSNPSSIAQWAALEALDGPQDFIAENNKVFKE
RRDLVVSMLNQAKGLHCPKPEGAFYVFPSCAGTIGKKTPEGKVIATDEDFATELLSAEGV
AVVHGSAFGLGPAFRISYATATSDLEEACRRIQRFCGALV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagccttctctcgtccgccctcaagcgtatcaagccctcgcccaccatcgccatttcc
aacaaggcgcgtgagctgaaggccaccggacgtgacatcatcgccctcagcgccggcgag
cccgatttcgacacgccggacaacatcaaggaagcggccatcgcggccatccgccggggc
gagaccaagtataccgccgtggatggcatgcccgagctgaaggcggccatctgccgcaag
ttcaagcgcgagaacggtctcgactacaagccctcgcaggtcacggtcggcaccggcggc
aagcaggtgctgttcaatgccctggtcgcgacggtggacgccggcgacgaggtgctgatt
cccgcccccttctgggtgagctatccggacatcgtggaattctgcggcggcaagcccgtc
tccgtgccgaccacgatcgaggacaatttcaagctgcgtccggacgtgctggaagcccac
atcacgccgaagaccaagtggctgatcttcaactccccgtccaatccgtcgggcgccgcc
tacagcttcgatgagctgaaggccctcaccgacgtgcttctgcgccacccgcacgtcatg
atcctcacggacgacatgtacgagcacctcgtctatgacgacttcaagttcgtcaccccg
gcgcaggtggagccgcagctctacgaccgcacgctgaccatgaacggcgtgtccaaggcc
tattgcatgaccggctggcgcatcggctatgcggccggccccgaggccctgatcaaggcc
atcggcacgctgcagtcgcagtccacctccaacccctcctccatcgcccagtgggcggcg
ctcgaggcgctggatggtccgcaggacttcatcgccgagaacaacaaggtgttcaaggag
cgccgcgatctcgtggtctccatgctgaaccaggccaagggtctgcattgcccgaagccg
gaaggcgccttctacgtgttcccgtcctgcgccgggaccatcggcaagaagacccccgag
ggcaaggtcatcgccacggacgaggatttcgcgaccgaactcctgagcgcagaaggcgtt
gcggtggtccatggctcggccttcggcctcggcccggccttccgtatctcctatgcgacg
gcgacctcggatctcgaggaagcctgccgccgcatccagcgcttctgtggcgcattggtc
tga

DBGET integrated database retrieval system