KEGG   Azorhizobium caulinodans: AZC_3133Help
Entry
AZC_3133          CDS       T00609                                 

Definition
(GenBank) protein of unknown function
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF992
Motif
Other DBs
NCBI-ProteinID: BAF89131
RhizoBase: AZC_3133
UniProt: A8IBX8
Position
3590621..3591103
Genome map
AA seq 160 aa AA seqDB search
MKTVFKAGIAAALACAGIAFAAPASAANIQVGTLVCTVAPNVSFVIGSVRQLDCNFRPSV
RGAKAGKYAGTVRRFGLDVGISGQQTLVWGVLAPTRRVSPGDLAGTYVGATANAAVGLGV
GANALVGGSRNSFTLQPVSVEGGTGLNVGLTVSDLTLTAR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgtctttaaggctggcattgccgccgcgctcgcttgcgctggcatcgcgttc
gctgcccccgcttcggccgcgaacatccaggtgggcaccctcgtgtgcaccgtcgcgccc
aacgtcagcttcgtgatcggctcggtccggcagctcgactgcaacttccgtccgagcgtg
cgcggcgccaaggccggcaagtatgccggcacggtccgccgcttcggcctcgacgttggc
atctccggccagcagacgctggtgtggggcgtgctcgccccgacccgccgcgtctctccg
ggcgacctcgccggcacctatgtgggcgccaccgcgaacgccgccgtcggcctcggtgtg
ggagccaatgcgcttgtgggtggctcgcgcaactccttcaccctgcagccggtctcggtt
gaaggcggcacgggcctcaatgtcggcctgaccgtctccgacctcacgctcaccgcgcgc
tga

DBGET integrated database retrieval system