KEGG   Azorhizobium caulinodans: AZC_3134Help
Entry
AZC_3134          CDS       T00609                                 

Definition
(GenBank) protein of unknown function
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF992
Motif
Other DBs
NCBI-ProteinID: BAF89132
RhizoBase: AZC_3134
UniProt: A8IBY0
Position
3591186..3591716
Genome map
AA seq 176 aa AA seqDB search
MRLMSVLSAAAVVGAAFAAAPASAQTAPKVQVGVLSCKVAPGVGLVFASSRQISCDFLTG
TPTAPVVSAQYTGTVNRYGVDLGATGAGTLQWGVFAPSTSPKAVDLTGKYVGATANVAVG
FGGGANVLLGGSNQTIALQPVSVEGMTGLTVAAGIGDLTLTPVPAAKPAKRAKYVK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcatgtctgttctctccgccgccgccgtggtcggtgcggcgttcgctgctgcc
ccggcttccgcgcagaccgcgccgaaggtccaggtcggcgtcctgtcgtgcaaggtggct
ccgggcgtcggcctggtgttcgcctccagccgccagatctcctgcgacttcctgaccggc
accccgaccgccccggtcgtctccgcccagtacaccggcaccgtgaaccgctacggcgtc
gacctcggcgccaccggcgccggcacgctgcagtggggcgtgttcgcgccgtccacctcg
cccaaggctgtcgacctgaccggcaagtatgtcggcgcgaccgcgaatgtggccgtgggc
ttcggcggcggcgccaacgtgctgctcggcggctccaaccagaccatcgcccttcagccc
gtctccgtggaaggcatgaccggcctcaccgtcgcggctggcatcggcgacctgaccctc
acgcccgtcccggctgccaagccggccaagcgcgccaagtacgtcaagtga

DBGET integrated database retrieval system