KEGG   Azorhizobium caulinodans: AZC_3140Help
Entry
AZC_3140          CDS       T00609                                 

Definition
(GenBank) putative glutathione S-transferase family protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: BAF89138
RhizoBase: AZC_3140
UniProt: A8IBZ6
Position
3595613..3596254
Genome map
AA seq 213 aa AA seqDB search
MRPPKSPRNAHPSGAAMPLRLRHSPASPFVRKCRLAAAVLGIPLELEPCDTTDPTDSIST
QNPLGKIPALLLEDGEVLFDSPVIVAYLDHLGGNKLIPAEPKARFAALKLEALADGMADA
ALLQIYEHRYRPEGMQVQSWLDKQAAKVSRALESLEANPPSEALTNGAIALASALGYLDL
RFKGEWRSGHPKLVAWLEAFKAKVPAFAETTVV
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcccaaatccccccgcaacgcgcatccttccggagccgccatgcccttgcgt
ctgcgtcactctcccgcttcgcccttcgtccgcaagtgccgcctcgcggcagccgtgctg
gggattccgctcgaactcgagccctgcgatacgacggacccgaccgacagcatctcgacc
cagaacccgctgggcaaaattccggcgctgctgctggaggatggagaggtgctgttcgat
tcgccggtgatcgtcgcctatctcgaccatctgggcggcaacaagctcatcccggctgag
cccaaggcgcgcttcgcggctctgaagctggaagcgctggcggacgggatggccgatgcc
gcactcctgcagatctacgaacaccgctatcgccccgagggcatgcaggtgcagagctgg
ctggacaagcaggcggccaaggtgtcccgcgcgctggagtcgctggaggccaatccgccg
tcggaggccctgacgaacggcgccatcgcgctggccagcgcgctcggctatctcgacctg
cgcttcaagggggaatggcgctccggccacccgaagctcgtcgcgtggctggaggctttc
aaggcgaaggtcccggctttcgccgaaacgaccgtcgtctga

DBGET integrated database retrieval system