KEGG   Azorhizobium caulinodans: AZC_3141Help
Entry
AZC_3141          CDS       T00609                                 

Definition
(GenBank) protein of unknown function
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1236 Gly-zipper_YMGG DUF456 TraT Romo1 Bacteriocin_IIc DUF3482 Gly-zipper_Omp MccV
Motif
Other DBs
NCBI-ProteinID: BAF89139
RhizoBase: AZC_3141
UniProt: A8IBZ8
Position
complement(3596306..3596695)
Genome map
AA seq 129 aa AA seqDB search
MRNGILASTVALSLLTPVAAFAQASTATGAVGGAAVGAVVGGPVGAVVGGVAGASIGAAA
EPPAEVRSYVIQERRPSVRVEREVVVGEPLPSNVQLYTIPNNNAYEYTVVNDRRVIVEPR
TRKVIQVIE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaatggaattcttgcttcgactgtagccctgtctctgctcacgcccgtggcggcg
ttcgcgcaggcttcgaccgcgacgggcgccgtgggtggcgcggccgttggtgcggtggtg
ggcggtcccgtgggtgccgttgtcggcggcgttgcgggcgcgtccatcggcgcggcggcg
gagccgccggcggaggtgcggtcctacgtgattcaggagcgccgcccctcggtgcgcgtg
gagcgcgaggtggtggtgggtgagcccctgccgtccaacgtgcaactctacaccatcccg
aacaacaacgcctatgagtacaccgtggtgaacgaccggcgcgtcatcgtcgagccgcgc
acccgcaaggtgatccaggtcatcgagtga

DBGET integrated database retrieval system