KEGG   Azorhizobium caulinodans: AZC_3143Help
Entry
AZC_3143          CDS       T00609                                 

Definition
(GenBank) hypothetical protein
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAF89141
RhizoBase: AZC_3143
UniProt: A8IC03
Position
3598533..3599438
Genome map
AA seq 301 aa AA seqDB search
MQAYDVLLEDWRAGVPAPDGQGWCFGLPPGLRPEQWPLDPHTGVPMMHGFTLLLPEDYRV
HGPDLVAVSFFATAPDGFDGSPMDGPEGMAEAVTAEAPPSDPALRPYWDRAQRSHPRLTR
IEDILGCAFAAILLTAEEFAGPPCRPPAPVDSPLAAGAPALDWLSRGSAAAYEAFNARLA
PPVAADDPFLIHRPIRWQPRASDPNAGKPPRESWDGTPPDGGYESHFYWLDGKLKVENWR
EHDWAAGHAPMHIGGTMRPVQAIPEFSPYYIEFEEDFGGYNFGGGNAQLDFKEMKFDWAC
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttacgacgtgctgctggaggactggcgcgcgggcgtgccggctccggacggt
cagggttggtgcttcggtttgccgccgggcctcagacccgagcaatggccgctcgatccg
cacaccggcgtgccgatgatgcacggcttcacgctgctgttgcccgaggattaccgggta
catggaccggacctggtggccgtctccttcttcgccaccgcccccgacggtttcgacggc
agccccatggacgggccggagggcatggcggaggccgtcaccgccgaggcgccgccctcc
gatccggcgctgcggccctactgggaccgcgcgcaacggtcccatccccggctgacgcgc
atagaggacatcctcggctgcgcctttgcggccattctcctgacggcagaggaattcgcc
ggcccgccgtgccgcccacccgcgccggtggacagcccgctcgcggcgggagcgcccgcg
ctcgactggctctcgcgcggctcggcagcggcctatgaggccttcaatgcccgcctcgcg
ccgccggtcgcggcggacgatccctttctcatccaccgacccatccgctggcagccccgc
gccagcgaccccaatgccggcaagccgccacgcgaaagctgggacggcacgccgccggat
ggcggctacgagtcccatttctactggctggacggcaagttgaaggtggagaactggcgc
gagcacgactgggcggccggccatgcaccgatgcacatcggcggcaccatgcggcccgtg
caggccattcccgaattcagcccctattacatcgagttcgaggaggacttcgggggctac
aatttcggtggcggcaacgcccagctcgacttcaaggagatgaagttcgactgggcgtgc
ggttga

DBGET integrated database retrieval system