KEGG   Azorhizobium caulinodans: AZC_3145Help
Entry
AZC_3145          CDS       T00609                                 

Definition
(GenBank) Maf-like protein
  KO
K06287  septum formation protein
Organism
azc  Azorhizobium caulinodans
Brite
KEGG Orthology (KO) [BR:azc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    AZC_3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Maf
Motif
Other DBs
NCBI-ProteinID: BAF89143
RhizoBase: AZC_3145
UniProt: A8IC08
Position
complement(3599651..3600271)
Genome map
AA seq 206 aa AA seqDB search
MNDRVQLVLASGSPRRLALLNQAGIQPDRLMPADVDETPERGELPRRLALRLAQQKGELV
ASRCREADIPALVIAADTVVAAGRRILPKPELQEEAEACLRLLSGRAHRVFTGLCLVTPK
GRVRTRLVESRLRFKRLTSEDIAAYLACGEWRGKAGGYAIQGIAGSFVVKLTGSYTSVVG
LPLAETVALLNGEGYPVRTGWVESAA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgaccgggtccagctcgtgctcgcttcggggtcgccccgcaggctcgctctgctc
aatcaggccggcatccagccggaccggctcatgcccgcggacgtggacgagacgcccgag
cgcggcgaactcccgcgccggctcgccctgcgcctcgcgcagcagaagggcgaactggtg
gcctcccgctgccgcgaggcggacattccggctctcgtgattgccgccgatacggtggtg
gcggcgggacggcgcatcctgcccaagcccgagttgcaggaagaggcggaggcctgcctg
cgcctgctctccggccgtgcccaccgggtgttcaccggcctgtgcctcgtgacccccaag
gggcgcgtgcgcacccgtctcgtcgagagccgcctgcgcttcaagcgcctgacgtcggag
gacatcgcggcctatctcgcctgcggcgaatggcgcggcaaggcgggtggctatgccata
cagggcatcgccggcagcttcgtcgtgaagctcaccggctcctacaccagcgtggtcggc
ctgccgctcgccgagacggtggcgctcctgaacggcgagggctaccccgtccgaaccggc
tgggtggagagcgccgcatga

DBGET integrated database retrieval system