KEGG   Azorhizobium caulinodans: AZC_3147Help
Entry
AZC_3147          CDS       T00609                                 

Definition
(GenBank) low molecular weight phosphotyrosine protein phosphatase
Organism
azc  Azorhizobium caulinodans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LMWPc
Motif
Other DBs
NCBI-ProteinID: BAF89145
RhizoBase: AZC_3147
UniProt: A8IC14
Position
complement(3601646..3602110)
Genome map
AA seq 154 aa AA seqDB search
MEPSVPADRSARPQSVLFLCGQNVVRSVMAAALARHLFGKSIYIASAGVIAGEADPFVAA
AMDEIGLDVSRHRPRSLEELEEYEGLSFDLAISLSPDAHHLALEATRTNALTVEYWPTPD
PTLETGNREQRLAAYRQVREDLEQRIRARFKPGR
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggagccgtccgtaccggcggatcggtcggcgcggccgcagtccgttctgttcctctgc
gggcagaatgtggtgcgctccgtcatggccgcggcgcttgcccgccatctgttcggcaag
tccatctatatcgcctcggcgggcgtgatcgccggggaagcggacccgttcgtggcggcg
gccatggacgagatcgggctggacgtctcccgccaccgcccgcgcagcctcgaggaactt
gaggaatatgaggggctgagcttcgacctcgccatctcgctgtcgcccgatgcgcaccat
ctggcactggaggcgacgcgcaccaatgcgctgacggtcgaatactggccgacgcccgat
ccgactctggagaccggaaaccgcgagcagcgcctcgccgcctatcgtcaggtgcgcgag
gacctggagcagcgcatccgcgcccggttcaagcccgggcgctga

DBGET integrated database retrieval system