KEGG   Azorhizobium caulinodans: AZC_3151Help
Entry
AZC_3151          CDS       T00609                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
azc  Azorhizobium caulinodans
Pathway
azc00520  Amino sugar and nucleotide sugar metabolism
azc00550  Peptidoglycan biosynthesis
azc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AZC_3151
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AZC_3151
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:azc01011]
    AZC_3151
Enzymes [BR:azc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     AZC_3151
Peptidoglycan biosynthesis and degradation proteins [BR:azc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   AZC_3151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase PsbU
Motif
Other DBs
NCBI-ProteinID: BAF89149
RhizoBase: AZC_3151
UniProt: A8IC24
Position
complement(3604740..3606029)
Genome map
AA seq 429 aa AA seqDB search
MDKIRIIGGGSLNGTIPISGAKNAALPLMIAALLSEEKLVLENVPRLADVALLQRILGNH
GVDITVNGKRNGDDPHAGQTMEIDARVIVDTTAPYDLVSRMRASFWVVGPLLARMGEARV
SLPGGCAIGTRPVDFHLDALRALGADIDIDAGYVVARAPHGLTGARIVFPKVSVGATHTA
IMAAALAKGDTVIENAAREPEIVDLADCLIKMGARIEGAGTSTIEISGVPRLRGARHSVL
PDRIETGTYAMATAMTGGDVTLAGARADLLESALDVLRKAGAQIDVNNEGIRVRRNGAGI
FPVEVSTAPHPGFPTDLQAQLMALMTRAQGRSRITETIFENRFMHVQELARLGANIHLEG
DTAIVEGSDRLKGAPVMATDLRASVSLVIAGLAAEGETMIQRVYHLDRGFERLEEKLSRC
GAQIERISG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggacaagattcgcatcatcggcggcggcagcctcaacggcaccattccgatctccggt
gccaagaatgccgccctgccgctgatgatcgcggcgctgctctcggaagagaagctggtg
ctggagaatgtgccgcggctcgcggacgtggcgctgctccagcgcattctcggcaaccac
ggcgtggacatcacggtcaacggcaagcgcaacggggacgatccccacgccggccagacg
atggagatcgacgcccgcgtgatcgtcgataccaccgcgccctatgatctcgtgtcccgg
atgcgggccagcttctgggtggtcgggccgctgctggcgcgcatgggcgaggcccgcgtc
tcgcttcccggcggctgcgccatcggcacccggcccgtggacttccatctcgatgccctg
cgggcgctgggcgccgatatcgacatcgatgccggctatgtggtcgcccgcgcgccgcac
ggcctcaccggtgcccgcatcgtgttcccgaaggtgtcggtgggcgcgacccacaccgcc
atcatggcggcggccctcgccaagggcgatacggtgatcgagaacgccgcccgcgagccc
gagatcgtcgatctcgccgactgcctcatcaagatgggcgcacggatcgagggcgcgggc
acgtccaccatcgagatttccggtgtgccgcgcctgcgcggcgcgcgccattcggtcctg
cccgaccgcatcgagacgggcacctatgccatggccacggccatgaccggcggcgatgtg
acgctcgccggcgcgcgggcggacctgctcgagagtgcgctcgatgtgctgcgcaaggcg
ggcgcgcagatcgacgtgaacaacgagggcatccgcgtccgccgcaacggcgcgggcatc
ttccccgtggaggtctccacggcgccgcatccgggcttcccgaccgaccttcaggcccag
ctcatggccctgatgacgcgggcccagggccgctcgcgcatcaccgagaccatcttcgag
aaccgcttcatgcatgtgcaggaactggcccgtctcggcgccaatatccatctggagggc
gacaccgccatcgtggagggctccgaccgcctcaagggcgccccggtgatggcgaccgac
ctgcgtgcctccgtgtccctcgtcatcgccggccttgccgccgagggcgagaccatgatc
cagcgcgtctatcacctcgaccgcggcttcgagcggctggaggagaagctctcccgctgc
ggcgcgcagatcgagcgcatcagcggctga

DBGET integrated database retrieval system