KEGG   Azorhizobium caulinodans: AZC_3153Help
Entry
AZC_3153          CDS       T00609                                 

Definition
(GenBank) methyl-accepting chemotaxis receptor
  KO
K03406  methyl-accepting chemotaxis protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc02020  Two-component system
azc02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:azc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AZC_3153
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    AZC_3153
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:azc02035]
    AZC_3153
Bacterial motility proteins [BR:azc02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    AZC_3153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAS_3 MCPsignal PAS_4 PAS_9 PAS PAS_8 Myosin_tail_1 Laminin_I ZapD SesA IFT57 EzrA DUF1664 DUF948
Motif
Other DBs
NCBI-ProteinID: BAF89151
RhizoBase: AZC_3153
UniProt: A8IC31
Position
3606945..3608585
Genome map
AA seq 546 aa AA seqDB search
MALSRPVRPTPKPNWYACHIKANSGSNAAGRRLAEASLSAATKVTTPVLRGRPMFPWFNA
KIDAQTIKALDRSLAIIEFTPSGDVITANANFLKVVGYSLDEIRGRHHRTFMDPVEAQSP
EYQAFWTSLGKGQFYAGEFRRFGKGGHEAWLEATYNPVMDASGRVIKVVKFASDITERKR
RTAEFEGQVAAISKSQAVIHFTLDGTITEANQNFLDALGYRLEEIQGRHHSMFVSPEEKN
SPSYRAFWDALRRGEYQQAEYKRLGKGGKEVWIQATYTPIFDAAGKPFKVVKFATDITEA
VKQRMHRAGVQKEIAADLERISQELTQANTQAASASAAAEQTAGNVQSVAAAAEELAASV
EEIRRQIHQSSTLARTAASEGARTNTIVTSLTGAAQKIGDVVSLIDSIAEQTNLLALNAT
IEAARAGDAGKGFSVVAQEVKSLAGQTSKATSEIASQIEAVQQVTQQAVQALGSITGTIS
DLNDVASVIASAVEEQTAVTREVSSNMQGAAQGVEMVKANMNAIAGSTNQVEQATRQVRQ
AAASIA
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
ttggctttgtctcgcccggtccgccctacgccgaagcccaactggtatgcttgccatata
aaggcaaattccggctccaacgcagcaggacggcgactggcagaagcgtcattgtctgcc
gcgacaaaggtaacgacaccagtgctgagggggcgacccatgtttccatggttcaacgca
aagattgatgcccagacgatcaaggcgctcgaccggtcgctggcgatcatcgagttcacg
ccatctggagacgtgatcaccgccaatgcgaacttcctgaaggtggtgggctattcactc
gacgagatccgtggccggcatcaccggaccttcatggacccggtagaggctcagagcccg
gagtaccaggccttctggaccagcctcggcaaggggcagttctatgccggcgagttccgc
cgcttcggcaagggcgggcacgaagcctggctggaagccacctacaatcctgtcatggac
gcctccgggcgcgtcatcaaggtggtgaagttcgcctccgacatcaccgagcgcaagcgc
cgcaccgccgagttcgagggtcaggtggccgccatctccaagtcgcaggcggtgatccac
ttcaccctggacggcaccatcacggaagcgaaccagaacttcctcgatgccctcggctat
cgccttgaggagatccagggtcgccaccactccatgttcgtgtcgcccgaggaaaagaac
agcccctcctaccgcgccttctgggatgcgctgcgccggggcgaataccagcaggcggaa
tacaagcggctgggcaagggcgggaaggaagtctggatccaggccacctacacgcccatc
ttcgatgccgcgggcaaacccttcaaggtggtgaagttcgccaccgacatcaccgaggcc
gtgaagcagcgcatgcatcgtgccggcgtgcagaaggagatcgccgccgatctcgagcgc
atcagccaggaactgacgcaggccaacacgcaggcggcctccgcctctgccgccgccgag
cagacggcgggcaacgtgcagtcggtggcggctgccgccgaggaactggcggcctccgtc
gaggagatccgccggcagatccaccagtcgagcacgcttgcgagaacggcggcgagcgag
ggcgcgcgcaccaacaccattgtcacgagcctcaccggcgccgcgcagaagatcggcgac
gtggtgagcctcatcgattccatcgccgagcagaccaacctgctggcgctcaacgccacc
atcgaggccgcgcgtgcgggcgatgccggcaagggcttctccgtggtcgcgcaggaggtg
aagagcctcgccggccagacctccaaggccaccagcgagatcgcctcgcagatcgaggcg
gtgcagcaggtcacgcagcaggcggtgcaggccctcggctcgatcaccggcaccatctcc
gacctcaacgacgtggcctcggtcatcgcatcggcggtggaggagcagacggcggtgacg
cgcgaggtctcctccaacatgcagggggcggcccagggcgtcgagatggtgaaggccaac
atgaatgccatcgccggctcgaccaaccaggtggaacaggcgacccgtcaggtccgccag
gcggcggcgtccatcgcctga

DBGET integrated database retrieval system