KEGG   Azorhizobium caulinodans: AZC_3163Help
Entry
AZC_3163          CDS       T00609                                 

Definition
(GenBank) ABC transporter substrate binding protein
  KO
K15553  sulfonate transport system substrate-binding protein
Organism
azc  Azorhizobium caulinodans
Pathway
azc00920  Sulfur metabolism
azc02010  ABC transporters
Module
azc_M00436  Sulfonate transport system
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AZC_3163
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AZC_3163
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:azc02000]
    AZC_3163
Transporters [BR:azc02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Sulfonate transporter [MD:M00436]
    AZC_3163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMT1 NMT1_2 Phosphonate-bd SBP_bac_3 NMT1_3
Motif
Other DBs
NCBI-ProteinID: BAF89161
RhizoBase: AZC_3163
UniProt: A8IC55
Position
3618096..3619070
Genome map
AA seq 324 aa AA seqDB search
MTGFLPTRRALMAAALGLMAASLPARAEAPKEIRIDWATYNPVSLVLKDQKLLEQEFAKD
GITIRWVQSAGSNKALEFLNAGSLDFGSTAGAAALIGKINGNPIKSVYVYSRPEWTALVT
RPDTGIKTVADLKGKTVAVTRGTDPHIFLVRALAANGLTEKDVKLVLLQHADGRLALQRK
DVDAWAGLDPIMASAEVEDGAVLFFRKPEDNTWGVLNVREDFAKANPDIVKRVLATYEKA
RLWSVQHPKDLSAALVSATKLPEPVIARQLERTDLSFGPIGKAQKDTILAAGEALQKAGV
VAADVNVPAQADALIDGQYLIVGQ
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcttcctgcccacccgccgcgccctcatggccgccgccctcggcctcatggcc
gccagcctgcccgcccgcgccgaggcgcccaaggagatccgcatcgactgggcgacctat
aatccggtctccctcgtgctcaaggaccagaaactgctggagcaggaattcgcgaaagac
ggcatcaccatccgctgggtgcagtccgccggctccaacaaggcgctggaattcctcaat
gccggctcgctggacttcggctcgaccgctggcgcggcggcgctgatcggcaagatcaac
ggcaaccccatcaagtccgtctatgtctattcccgtccggaatggacggcgctggtgacc
cggccggacaccggcatcaagaccgtcgccgacctcaagggcaagacggtcgcggtgacc
cgcggcaccgatccgcacatcttcctcgtgcgggcgctcgccgccaacggcctcacggag
aaggacgtgaagctggtgctgctccagcacgcggacgggcgcctcgccctccagcgcaag
gatgtggacgcctgggcgggcctcgatcccatcatggcctcggccgaggtggaggacggc
gccgtgctcttcttccgcaagcccgaagacaacacctggggcgtgctgaacgtgcgcgaa
gatttcgccaaggcgaacccggacatcgtgaagcgcgtgctcgccacctatgagaaggcg
cgcctctggtcggtgcagcatcccaaggatctgtccgccgcgctcgtctcggccaccaag
ctgcccgagccggtcatcgcccggcagcttgagcgcacggatctctccttcggccccatc
ggcaaggcgcagaaggacaccatcctcgccgccggcgaagcgctccagaaggcgggcgtc
gtcgccgccgacgtcaacgtgccggcgcaggcggatgcgctcatcgacggccagtatctc
atcgtggggcagtga

DBGET integrated database retrieval system