KEGG   Azorhizobium caulinodans: AZC_3167Help
Entry
AZC_3167          CDS       T00609                                 

Definition
(GenBank) sulfite oxidase and related enzymes
  KO
K17225  sulfane dehydrogenase subunit SoxC
Organism
azc  Azorhizobium caulinodans
Pathway
azc00920  Sulfur metabolism
azc01100  Metabolic pathways
azc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:azc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AZC_3167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb Mo-co_dimer Cuticle_1 BNR
Motif
Other DBs
NCBI-ProteinID: BAF89165
RhizoBase: AZC_3167
UniProt: A8IC65
Position
complement(3621811..3623064)
Genome map
AA seq 417 aa AA seqDB search
MSVASSGGRLGRRQFLSGAAAGLVAGAAGPAAAQQGSGPLQVPVWTREQGEGIASPAYGV
PSAFEKSVIRKPRTPPKFPTAASTGTPLQHLHGIITPAGLHYERHHAGVPAIDPEQHRLV
IHGLVERPLILTMNDIARFPSVSRLWFLECSGNTPQWTGGSAKWTVQETHGLISCSEWTG
VRLSTLLDEVGLKPEARWVLAEGADGAAMTRSIPLDVVLDEALVAYAQNGEHLRPEQGYP
LRLVLPGIEGNMSIKWLRRLKVGDQPFQSREETSKYTDLMPDGTARQFTFVMETKSVITS
PSGGHQLREKGFYEIRGLAWSGRGRIRSVDVSTDGGATWRPAELQEPVLSRCLTRFRVPW
TWDGGPALLQSRAVDETGYVQPSRQQLVDVRGVNSQYHFNGIQTWKVAPSGEVTNAA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgcgtcttccggcggccgcctcggccgccgccagtttctgagcggtgccgct
gccggcctcgtggcgggtgccgccggccctgcagccgcgcagcagggctcaggtccgctt
caggtgcctgtctggacgcgggagcagggtgagggcatcgcttcacccgcctatggcgtg
ccctcggccttcgagaagagcgtgatccgcaagccgcgcacgccgcccaaattcccgacc
gccgcctccaccggcacaccgttgcagcatctgcacggcatcattaccccggccggcctg
cattatgagcgccaccatgctggcgtgccggccatagacccggagcagcatcgcctcgtc
atccatggccttgtggagcgcccgctcatcctgaccatgaacgatatcgcgcgctttccg
tccgtctcgcgcctctggtttctggagtgctccggcaatacgccgcaatggaccggcggc
agcgccaaatggaccgtgcaggagacccacggcctcatctcgtgcagcgagtggaccggc
gttcggctctccaccctgctcgatgaagtgggcctgaagccggaggcccgctgggtgctg
gcggaaggcgcggacggcgccgccatgacgcgctccatcccgctcgatgtggtgctggat
gaggcattagtcgcctatgcgcagaatggcgagcatctgcgccccgagcagggttatccg
ctgcgcctcgtgctgcccggcatcgagggcaacatgagcatcaagtggctgcgccgcctc
aaggtgggcgaccagccgttccagagccgtgaggaaacgtccaaatacacggacctgatg
cccgacggcacggcgcggcagttcaccttcgtcatggagacgaagtcggtcatcacctcg
ccttccggcggccaccagttgcgggagaagggtttctatgaaatccggggcctcgcctgg
tccgggcgcgggcgcatccgcagcgtcgatgtcagcaccgacggcggcgccacatggcgg
ccggcagaattgcaggagccggtgctctcccgctgcctcacccgcttccgcgtgccctgg
acctgggatggcgggccagcccttctccagagccgcgcggtcgacgagaccggctatgtg
cagccgagccgccagcagctcgtggacgtgcgcggcgtcaattcccaataccatttcaac
ggcatccagacctggaaggtggcgccgtccggcgaggtgaccaatgcggcctga

DBGET integrated database retrieval system